Structural and functional characterization of TRX16, a thioredoxinlike protein and altering substrate specificity of a serine protease inhibitor

... STRUCTURAL AND FUNCTIONAL CHARACTERIZATION OF TRX16, A THIOREDOXIN-LIKE PROTEIN AND ALTERING SUBSTRATE SPECIFICITY OF SPI1, A PROTEASE INHIBITOR PANKAJ KUMAR GIRI A THESIS SUBMITTED ... Farré and Casado, 2001; Laroux et al., 2001), atherosclerosis and other cardiovascular disorders, inflammation and chronic inflammation (Laroux et al., 2001; Latha and Babu, 2001), burns (Latha ... stress and characterization of its interaction with NF-kB Chapter IV presents the structure based rational design of altered specificity of a protease inhibitor Protease inhibitors play a decisive...

Báo cáo hóa học: " Identification and characterization of alkaline serine protease from goat skin surface metagenome" docx

... al.: Identification and characterization of alkaline serine protease from goat skin surface metagenome AMB Express 2011 1:3 Submit your manuscript to a journal and beneﬁt from: Convenient online ... and Gly-Thr-SerMet-Ala-X-Pro, which is characteristic of serine subfamily S8A Results from the sequence analysis of this protease suggested it to be serine protease subfamily S8A Expression of ... stearothermophilus protease promoter Protease promoter represents the predicted alkaline serine protease promoter region E coli protease promoter represents, E.coli lon protease promoter Effect of pH and temperature...

Báo cáo Y học: Structural and functional characterization of a C-type lectin-like antifreeze protein from rainbow smelt (Osmerus mordax) potx

... digestion fragments of untreated and deglycosylated AFP 1222 J C Achenbach and K V Ewart (Eur J Biochem 269) Ó FEBS 2002 Fig Analysis of antifreeze activity Antifreeze activity was evaluated qualitatively ... chemicals were reagent grade Puriﬁcation of smelt AFP Blood plasma was obtained from a population of rainbow smelt (O mordax) caught in seawater along the northeastern coast of Newfoundland on ... staining when CaCl2 is added to the staining and washing buffer (Fig 1) Measurement of antifreeze activity Antifreeze activity was measured on equimolar amounts of deglycosylated and untreated...

Báo cáo khoa học: "Structural and functional characterization of the 5’ upstream region of a glutamine synthetase gene from Scots pine" pdf

... in all compared organisms We have also analyzed the presence of putative elements in the 5’ region of the gene There is a canonical TATA box at –35 bp from the transcription start site and a putative ... were used as controls 2.4 Gel retardation analysis A DNA fragment used for gel retardation analysis containing a sequence from the 5’- untranslated region of GS 1a was obtained by cleavage with ... with the reporter gene uidA and the presence of DNA-protein interactions in the 5’flanking region of GS 1a gene from Scots pine MATERIALS AND METHODS 2.1 Isolation of a genomic clone containing...

Structural and functional characterization of haditoxin, a novel neurotoxin isolated from the venom of ophiohagus hannah (king cobra

... β-cardiotoxin, an all β-sheet protein isolated from the venom of Ophiophagus hannah (king cobra) Manuscript under preparation xvi (5) Roy A, Sivaraman J, and Kini RM Structural and functional characterization ... forests and mangrove swamps in parts of Southeast Asia, South China and India Chapter One A B C Figure 1.1: Ophiophagus hannah (king cobra) and its geographical distribution (A) An adult king cobra ... hypotensive and vasorelaxant properties Isolated from the venom of Atractaspis engaddensis These isopeptides are structurally and functionally related to mammalian endothelins They are potent vacoconstrictors...

Báo cáo khoa học: Molecular and functional characterization of a novel splice variant of ANKHD1 that lacks the KH domain and its role in cell survival and apoptosis docx

... sequence VBARP-L 1.9 VBARP-S 1.3 AACAATGCTGACTGATAGCGGAGGA (Forward) TAAGCTACTACGTAAAGAATATATC (Reverse) GATAAGGTACCTGCACTGACACGGATGAAAGC (Forward) CATATATTCTTTACGTAGTAGCTTA (Reverse) FEBS Journal 272 ... identiﬁed and functionally characterized VBARP, a novel splice variant of ANKHD1 Human ANKHD1 gene is a large transcript containing multiple ankyrin repeat motif domains and a single KH domain similar ... Molecular characterization of ANKHD1 splice variant studies blast searches of VBARP revealed that this protein has homology to human ankyrin repeat and KH domain containing 1 (ANKHD1) variants,...

Báo cáo khoa học: Identiﬁcation and functional characterization of a novel barnacle cement protein pptx

... VPPPCDFSIKSKQKQVGVTAGGASVSAKGATSGSGSITCITKTPTSVTKKVAAGNAGVSG Mrcp19k Bacp19k Bicp19k 70 80 90 100 110 120 TSVSAGDGAFGNLAAALTLVEDTEDGLGVKTKNGGKGFSEGTAAISQTAGANGGATVKKA VSASAANGFFKNLGKATTEVKTTKDGTKVKTKTAGKGKTGGTATTIQIADANGGVSEKSL AAAAAGNGVFKNLVTALTNISTTDDITKVQTQTIGSGGTGGAATILQLADANGGAALKEV ... underwater material surfaces was analyzed by: (a) quantitative amino acid analysis; and (b) SPR Protein adsorption to glass and a positively charged polymer were evaluated by quantification of the ... GC-3¢ and 5¢-AAC TCC GTG GAG AAG AAG AA-3¢ for the first PCR amplification; and 5¢-TGC TGA CCG ACG CGC CTC CT-3¢ and 5¢-GGC AAC ACG GGC GTC ACC GC-3¢ for the second PCR amplification The 102 bp DNA amplified...

Báo cáo khoa học: Structural and functional characterization of human Iba proteins ppt

... cross-linking efciency of Iba1 and Iba2 or in the overall morphology of the generated lament bundles Calcium afnity of Iba1 and Iba2 Homodimerization and actin binding of Iba1 and Iba2 were similar ... presented here reveals functional similarities and differences between Iba1 and Iba2 We investigated Ca2+ binding and homodimerization of Iba1 and Iba2 Furthermore, F-actin binding and cross-linking ... Human Iba proteins J O Schulze et al study has revealed expression proles for most of the human transcripts and uncovered different tissuespecic expression of Iba1 and Iba2 [5] For Iba1 ,...

Báo cáo khoa học: Functional characterization of artemin, a ferritin homolog synthesized in Artemia embryos during encystment and diapause doc

... within negatively stained particles of artemin indicated the lack of metal storage capacity Function of an Artemia ferritin homolog A B C Artemin, apoferritin and ferritin inhibit citrate synthase ... denaturation Artemin, apoferritin and ferritin protected citrate synthase against denaturation at 43 °C in a concentrationdependent manner (Fig 3A C) Maximal protection was obtained at a chaperone ... strain BL21PRO (BD Biosciences Clontech) For expression in mammalian cells, artemin cDNA was ampliﬁed by PCR with primers 5¢-GATCCTCGAGTTAACTATAGAAGACACGGG-3¢ and 5¢-AGCTCCTAGGGCAACAGAAGGTGCAAG-3¢,...

Báo cáo sinh học: "Functional characterization of human Cd33+ And Cd11b+ myeloid-derived suppressor cell subsets induced from peripheral blood mononuclear cells co-cultured with a diverse set of human tumor cell lines" docx

... this article as: Lechner et al.: Functional characterization of human Cd33+ And Cd11b+ myeloid-derived suppressor cell subsets induced from peripheral blood mononuclear cells co-cultured with a diverse ... serum and regulated by association of a latency protein, precluded clear neutralization data Characterization of human CD33+ and CD11b+ suppressor cells induced by tumor cell lines To characterize ... on a BD FACSCalibur flow cytometer and data acquisition and analysis were performed as above Data are from three unique donors and expressed as a fraction of labeled cells within a live -cell gate...

Báo cáo y học: "Structural and functional characterization of human apolipoprotein E 72-166 peptides in both aqueous and lipid environments" pot

... concentration of DHPC Protein -lipid interactions and Protein-LDLR binding of ApoE- (72-166) Proteins To identify and compare the lipid binding ability of the three apoE- (72-166) peptides, we assessed ... Received: 17 September 2010 Accepted: 10 January 2011 Published: 10 January 2011 References Weisgraber KH, Rall SC Jr, Mahley RW: Human E apoprotein heterogeneity Cysteine-arginine interchanges ... apoE3 and apoE4, and with apoE2-, apoE3-, and apoE4- (72-166) proteins, respectively The VLDL bands were shifted with the binding of apoE proteins Detailed procedures are described in Materials and...

báo cáo khoa học: " Isolation and functional characterization of cold-regulated promoters, by digitally identifying peach fruit cold-induced genes from a large EST dataset" pptx

... gAgTTggATgggTCCTCTgC CCAAACCAAAgCCAgTTTCATTCA CCAggTTTTgTATgAgTgCCgTA ACCTTggCCATCCTCTTCTT AgAAATCTTgACCCCCgTTC AAggAgCTCTTgACgTTggA TgCTAACAggTgggAAAACC CCTTCCAgCAgATgTggATT AgATTAggCAAggCgAggAT BEC87-GSP1 ... TgATTTTAgCTgCATgTgCACCTgAgAA CgTCATggAAATgTCTTAATTggCTTgCTg gAAgAAAACAAATTgggAggAggAgAA gCgTgTTCCAAAgAACACAATTCAgTgCCTT BEC-32BamHI DX24BamHI ggATCCTgATCTgTggATTgggTTTCgTgg ggATCCgggTgTTgAACCAAAATgCgCCATT Method RT-PCR ... THA82-GSP1 THA-1-GSP2 LOX101-GSP1 LOX63-GSP2 TgCATTTCCAgCTTgCCTCCCACATTg CTgAgATCCCTAACAgCAAAgCTAgggATA ACCggTTCCggTggTggTgTgATgAACC ACTCATCAgTCTTAgTAggCTCgggTgTT TgATTTTAgCTgCATgTgCACCTgAgAA...

báo cáo khoa học: " Isolation and functional characterization of a cDNA coding a hydroxycinnamoyltransferase involved in phenylpropanoid biosynthesis in Cynara cardunculus L" potx

... 5'-ATGGCAACACTGTCAATTA-3' 5'-CCCGACGATCAGGATA-3' 5'-ACCGCCGGGATGAGTT-3' 5'-CCGCCTCCACGAACAA-3' 5'-TTCCGTTTCGTTTCTTCAA-3' 5'-TGGCCATAACCATTTTAGATAT-3' 5'-GGGTTTCATATGAAGATCGAGGTGAGAGAA-3' 5'-CGGGATCCTTAGATATCATATAGGAACTTGC-3' ... N-hydroxycinnamoyl/benzoyltransferase from I batatas (AB035183); AtHCT, shikimate/quinate hydroxycinnamoyltransferase of A thaliana (At5g48930); NtHCT, shikimate/ quinate hydroxycinnamoyltransferase of N tabacum (AJ507825); ... hydroxycinnamoyl CoA quinate transferase of N tabacum (CAE46932); LeHQT, hydroxycinnamoyl CoA quinate transferase of L esculentum (CAE46933); At2G19070 and At5G57840, A thaliana genes encoding putative...

Structural and functional characterization of signaling protein complexes

... List of Tables Page Table 1.1 List of common and important PTMs 23 Table 1.2 IQ motifs of established and potential CaM target proteins 37 Table 2.1 Data collection and refinement statistics of ... domains that mediate protein- protein, protein- lipid, and protein- DNA interactions (Fig 1.4) The most common protein- protein interaction domains in NRTKs are the Src homology (SH2) and (SH3) domains ... formation, crystallization and data collection Cloning of CaM, ΔNav1.6 Expression of ΔNav1.6 and association with CaM Expression and purification of CaM Pull down assays and gel filtration confirm...

Xem thêm

Từ khóa: identification and functional characterization of srnas in neisseria meningitidis purification reconstitution and functional characterization of zinc transporter from rat renal brush border membranes molecular and functional characterization of p glycoprotein in vitro forensic issues in the structural or functional neuroimaging of traumatic brain injury discovery and development of the hcv protease inhibitor tmc435 gbp cl5 and hemocyanin to bacteria is regulated by a serine protease maspin a novel serine protease inhibitor c57bl 6j mice with serine protease inhibitors reduced weight loss and viral load structural studies of the functional complexes of the 50s and 70s ribosome a major antibiotic target brachypodium distachyon a new model system for structural and functional analysis of grass genomes a comparison of structural and functional readouts structural and semantic features of english idioms referring to head and a contrastive analysis with vietnamese idioms 725 internal and functional behavior of a master slave s r flip flop 727 internal and functional behavior of a master slave j k flip flop 10 viewing and raising the functional level of a windows server 2003 or 2008 domain Báo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018 chuyên đề điện xoay chiều theo dạng Nghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoại Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit ĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN Quản lý hoạt động học tập của học sinh theo hướng phát triển kỹ năng học tập hợp tác tại các trường phổ thông dân tộc bán trú huyện ba chẽ, tỉnh quảng ninh Phối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọ Trả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)Phát hiện xâm nhập dựa trên thuật toán k means Nghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chế Nghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000 Tìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tin Thơ nôm tứ tuyệt trào phúng hồ xuân hương Sở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIX Chuong 2 nhận dạng rui ro chuong 1 tong quan quan tri rui ro Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật MÔN TRUYỀN THÔNG MARKETING TÍCH HỢP TÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲ