exploring the zebra finch taeniopygia guttata as a novel animal model for the speech language deficit of fragile x syndrome
Role of interleukin 13 on the development of minimal change nephrotic syndrome a novel animal model
... sequence of the rat IL-13 mRNA 217 Appendix 2.2 Setup of Polymerase Chain Reaction (PCR) 218 Appendix 2.3 TA Cloning, transformation and amplification of plasmid DNA 220 Appendix 2.4 Gel extraction and ... ii SUMMARY ix LIST OF ABBREVIATIONS xi UNITS OF MEASUREMENT xvi LIST OF TABLES xix LIST OF FIGURES xxi LIST OF APPENDICES xxiv LIST OF PUBLICATIONS AND CONFERENCE ABSTRACTS xxvi CHAPTER 1.1 INTRODUCTION ... subunits associate with tyrosine kinases of the Janus family Activation of JAKs initiates a series of downstream signal transduction events which leads to phosphorylation of STAT6, a transcription factor...
- 317
- 328
- 0
báo cáo hóa học:" Force-feedback interaction with a neural oscillator model: for shared human-robot control of a virtual percussion instrument" doc
... of the subjects in the same manner In the NF “no force–feedback” model, kC had the same value as MED except that the force–feedback was disabled Fifth Model NF–HINT The fifth model was somewhat ... obtained using the same model structure and applying b = α = 17 We found informally that it was generally easy to increase the amplitude of the oscillation, and it was often relatively easy ... was the skill level of the nth subject, D(c) was the intrinsic difficulty of the model c, and Ns was a random noise variable By taking the natural logarithm of both sides of (9), we arrived at a...
- 58
- 327
- 0
Báo cáo y học: "A novel preclinical model for rheumatoid arthritis research" pdf
... Compared to the macaque models, the marmoset model of CIA shows several advantages First of all, common marmosets are smaller and reach their adult age earlier than macaques, which saves capacity ... [11], allows the evaluation of the efficacy of therapeutics using a small number of animals Finally, in contrast to macaques, half of the common marmosets developed chronic arthritis This chronic arthritis ... type II collagen an experimental model of arthritis J Exp Med 1977, 146:857-868 Cathcart ES, Hayes KC, Gonnerman WA, Lazzari AA, Franzblau C: Experimental arthritis in a nonhuman primate I Induction...
- 2
- 176
- 0
Báo cáo sinh học: "Assessment of a Poisson animal model for embryo yield in a simulated multiple ovulation-embryo transfer scheme" potx
... capacity of the heterozygous animals, SC formation and the behaviour of the trivalent 5/15; ;15 was studied at the pachytene stage of meiosis = MATERIALS AND METHODS Two Saanen male goats (Capra ... Luciani JM, Guichaoua MR, Mattei A, Morazzani MR (1984) Pachytene analysis of a man with a 13q;14q translocation and infertility: behaviour of the trivalent and nonrandom association with the sex ... probability of variable pairing faces and leads to the conclusion that a single pairing face on the translocated chromosome determines the plane of SC assembly The cis configuration was also found in the...
- 9
- 265
- 0
Báo cáo sinh học: " Assessment of a Poisson animal model for embryo yield in a simulated multiple ovulation-embryo transfer scheme" pot
... biased upwards, but the bias was larger for BLUE in all cases This apparent paradox can be explained by the fact that BLUE is an unbiased estimator of: and not exp(p + H Empirical biases for the ... assess the sampling performance of Poisson MML in terms of empirical bias and square root MSE Relative bias was empirical bias as a percentage of the true variance component Coefficients of variation ... ’baseline’ value can then be interpreted as the expected value of the Poisson parameter of an observation made under the conditions of an ’average’ level of the fixed effects and in the absence of random...
- 28
- 297
- 0
Báo cáo y học: "Management of chest pain: exploring the views and experiences of chiropractors and medical practitioners in a focus group interview"
... clinical practice As a corollary example of an empirical 'treatment-based' diagnostic strategy, a presumptive diagnosis of gastroesophageal reflux disease (GERD) may be pragmatically validated ... nature of the referral (e.g., amount and type of information accompanying the referral) may depend on the nature of the condition, whether the referral is for reasons of diagnosis and/or treatment, ... medical participants both noted lack of formal clinical studies examining effectiveness of manual/manipulative approaches to manage (diagnose and treat) musculoskeletal chest pain, and lack of...
- 10
- 788
- 0
Báo cáo khoa học: Identification of mitogen-activated protein⁄extracellular signal-responsive kinase kinase 2 as a novel partner of the scaffolding protein human homolog of disc-large docx
... PlatiniumÒ Taq DNA High Fidelity Polymerase (Invitrogen) and the primers: PDZ-1-2, forward: 5¢-CCGAATTCGAAGAAATCACACTTGAAAGG-3¢, and reverse: 5¢GGATCCCCATCATTCATATACATACTTGT GGGTT-3¢; PDZ3, forward: ... least one MAPK implicated in ERK activation to facilitate a functional interaction and regulate the localization and the duration of the signal For example, the MEK partner directs the ERK cascade ... 5¢-GTGGGGAAATATGCTCTTGAGGAGGT-3¢; primers 2, forward: 5¢-GTGACTTCAGAGACACTGCCA-3¢, and reverse: 5¢-CCCTTTCAAGTGTGATTTCTTC3¢; primers 3, forward: 5¢-ACCAGATGGTGAGAGCGAT-3¢, and reverse: 5¢-CTGTCTTTCATAGGTCCCAAT-3¢...
- 11
- 419
- 0
Báo cáo khoa học: Identification of the N-terminal region of TjZNT2, a Zrt⁄Irt-like protein family metal transporter, as a novel functional region involved in metal ion selectivity ppt
... selectivity Tomatsu H, Takano J, Takahashi H, Watanabe-Takahashi A, Shibagaki N & Fujiwara T (2007) An Arabidopsis thaliana high-affinity molybdate transporter required for efficient uptake of molybdate from ... -MASSPTKILCDAGESDLCRDDAAAFLLKFVAIASIL 1:MFFIDVLWKLFPLYLFGSERDYLSETESILKIVPETMAAASSLSILCDAGEPDLCRDDSAAFLLKLVAIASIF TjZNT1 TjZNT2 37:LAGVAGVAIPLIGKNRRFLQTEGNLFVAAKAFAAGVILATGFVHMLAGGTEALTNPCLPDYPWSKFPFPGFFA ... in YNB medium at 30 °C, and imaged with a laser scanning confocal microscope (FV 1000; Olympus, Tokyo, Japan) Metal accumulation assay The Cd2+ accumulation assay was performed as described in...
- 8
- 343
- 0
Báo cáo y học: "Screening of an endothelial cDNA library identifies the C-terminal region of Nedd5 as a novel autoantigen in systemic lupus erythematosus with psychiatric manifestations" ppt
... interpretation of data MR carried out the ELISA experiments and participated in analysis of data CA performed the statistical analysis and the clinical associations AS participated in the analysis and ... G, Alessandri C, Capoano R, Profumo E, Siracusano A, Salvati B, Rigano R, et al.: Screening of a HUAEC cDNA library identifies actin as a candidate autoantigen associated with carotid atherosclerosis ... interpretation of data and in the revision of the manuscript RR participated in the design of the study and in the revision of the manuscript EP participated in analysis of data GV participated in the...
- 8
- 375
- 0
Báo cáo y học: " “The non-ischemic repair” as a safe alternative method for repair of anterior post-infarction VSD" pptx
... subsequently the proximal by partial clamping of the aorta (for the cases with more than one graft) After completion of the proximal anastomoses the extracorporeal circulation is interrupted and hemostasis ... beat empty of volume The last part of the operation is carried out using an off pump coronary artery bypass (OPCAB) stabilizer in order to perform the necessary distal coronary anastomoses and ... routinely place surgical gauze beneath the heart in order to appropriately elevate the apex and expose the site of rupture, as much as needed to avoid possible distortion of aortic valve and sequent...
- 4
- 369
- 0
Báo cáo y học: "Martial arts as a mental health intervention for children? Evidence from the ECLS-K" doc
... analysis with the change in behavior from third to fifth grade For each of these two analyses we used the cases available in the ECLS for that particular analysis Thus the sample sizes, and the ... behavior measured on a scale of to (the average of all of the items), the largest deviation from zero for either the upper or lower bound of a confidence interval was about a fifth of a point The ... have revealed at least a tiny visible effect, given the more than adequate sample size and given the reliability of the behavior rating variable The claims of martial arts studios and the expectations...
- 9
- 354
- 0
A novel interval method for validating state enclosures of the
... where m = for Case and m = for Case The interval enclosures for all state variables and the initial approximations xapp,1 (t) and xapp,2 (t) are shown in Fig In the considered time span, the improved ... solution a set of linear ODEs xapp (t) = flin (xapp (t)) ˙ (9) with the same dimension as the original system is solved analytically for xapp = xapp (0) = x0 + x0 Usually, the original state equations ... to the case of uncertain initial states to present the solver VAL E NC IA-IVP It aims at calculating tight enclosures [xencl (t)] for the unknown exact range [x (t)] of all reachable states for...
- 12
- 373
- 0
Báo cáo khoa học: "A Unified Statistical Model for the Identification of English BaseNP" pptx
... Street Journal distributed with the Penn Treebank II, and the definition of baseNP is the same as Ramshaw’s, Table summarizes the average performance on both baseNP tagging and POS tagging, each section ... identifiers assigned to POS tags We used the approach of Katz (Katz.1987) for parameter smoothing, and build a trigram model to predict the probabilities of parameter (1) and (3) In the case that unknown ... pruning may be regarded as the special case of our statistical model, since the maximum-matching algorithm of baseNP rules is only a simplified processing version of our statistical model Compared...
- 8
- 482
- 0
Improving Recapitalization Planning - Toward a Fleet Management Model for the High-Mobility Multipurpose Wheeled Vehicle ppt
... Recapitalization Planning: Toward a Fleet Management Model for the HMMWV Table 4.1 Fleet Management Model Assumptions in Sensitivity Analyses and Base Case Replace Earlier Base Case Replace Later ... rather than separate location variables and coefficients, and we treated the variant’s annual mileage-by-age figures as usage values in the equations After calculating EDA-based repair costs by age, ... Finally, as the availability and quality of Army data continue to increase, so, too, will the precision of model outputs For example, additional data on the failure rates of older vehicles and of...
- 92
- 499
- 0
Success as a real estate agent for DUMmIES
... a trained agent, the 50/50 arrangement doesn’t change as drastically as it can in the residential arena ߜ You construct your own database Commercial real estate is a database business For example, ... be available at the drop of a hat largely because agents have trained them to expect service 24 hours a day, days a week The National Association of Realtors ran a huge marketing campaign a few ... in office leasing you have to create a database of all the buildings in the marketplace and all the information about the buildings: Tenant lists, when leases are up, building features and amenities,...
- 380
- 902
- 1
Diaspora Bonds as a New Funding Vehicle for Developing Countries pdf
... viability of diaspora bonds as a development financing instrument The rise of various diasporas and their economic status in their adopted countries are fast becoming a source of pride as well as financial ... e.g., Korean and Chinese diaspora in Japan; Indian and Pakistani diaspora in the United Kingdom; Turkish, Croatian and Serbian diasporas in Germany; Algerians and 11 National Jewish Population Survey ... choose the law and the forum governing bond contracts Finally, factors that facilitate—or constrain the issuance of diaspora bonds include having a sizeable and wealthy diaspora abroad, and a strong...
- 24
- 298
- 0
Báo cáo khoa học: Neuropeptide S as a novel arousal promoting peptide transmitter pdf
... coeruleus area, the principle sensory nucleus and the lateral parabrachial nucleus of the brainstem A small number of scattered NPS-positive cells were found in other brain areas, such as amygdala and ... recent example for the impact of orphan receptor research on neuroscience and our understanding of brain functions The identification of NPS as a modulator of arousal and anxiety represents a first ... profile that was independent of the motor-activating effects of the peptide [11] NPS increased the time the animals spent exploring the less protected or brighter areas of the different test chambers...
- 5
- 394
- 0
ridge aperture antenna array as a high efficiency coupler for photovoltaic applications
... configuration is that the aperture array can serve as the front contact for the solar cell Silver is selected for the metal apertures and the top metal layer because of its low losses at optical frequencies ... This has led to the widespread use of wafer-based crystalline silicon solar cells1,2 where the wafers contribute a substantial portion of the expense of the module.2 The electrical and manufacturing ... absorbed in the silicon generates a single carrier pair which has the energy of the band gap (1.11 eV) Figure 4 (a) shows the results of this calculation for a = 750 nm as well as the bare silicon...
- 7
- 297
- 0
ridge aperture antenna array as a high efficiency coupler for photovoltaic applications
... configuration is that the aperture array can serve as the front contact for the solar cell Silver is selected for the metal apertures and the top metal layer because of its low losses at optical frequencies ... This has led to the widespread use of wafer-based crystalline silicon solar cells1,2 where the wafers contribute a substantial portion of the expense of the module.2 The electrical and manufacturing ... absorbed in the silicon generates a single carrier pair which has the energy of the band gap (1.11 eV) Figure 4 (a) shows the results of this calculation for a = 750 nm as well as the bare silicon...
- 7
- 302
- 0
Báo cáo hóa học: " A pilot clinical trial testing mutant von HippelLindau peptide as a novel immune therapy in metastatic Renal Cell Carcinoma" doc
... evidence of brain metastasis; history of autoimmune disease; history of other malignancies except basal cell carcinoma of the skin; and pregnancy The study protocol was approved by the Institutional ... EA participated in the patients care RI carried out the immunoassays AT carried out the immunoassays BG participated in the patients care VEH participated in the patients care WML analyzed the ... sequences The patients had different HLA alleles, as shown in Table Of the six patients enrolled in the trial, five were male and one was female (patient 2) Patients had an average age of 62 years,...
- 9
- 477
- 0
Tìm thêm: xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo gắn với các giáo trình cụ thể tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam nội dung cụ thể cho từng kĩ năng ở từng cấp độ mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn đặc tuyến hiệu suất h fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến tốc độ rôto n fi p2 đặc tuyến dòng điện stato i1 fi p2 sự cần thiết phải đầu tư xây dựng nhà máy phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25