0

example of a cover letter for a housekeeper

Tài liệu Báo cáo khoa học:

Tài liệu Báo cáo khoa học: "Detection of Japanese Homophone Errors by a Decision List Including a Written Word as a Default Evidence" docx

Báo cáo khoa học

... using various 1 '~' ~.,~. and '~.~ m~,' have a same phone 'i-sift'. The meaning of '~,' is a general will, and the meaning of '~:~'.~.,, is a ... will. '~.~.' and '~' have a same phone 'cho-kkan'. The meaning of 'l-ff__,~. i is an intuition through a feeling, and the meaning of '~' is an intuition ... Takahiro Saitoh, and Ku- nio Matsui. 1997. A new approach for Japanese Spelling Correction (in Japanese). SIG Notes NL-117-21, IPSJ. 186 Proceedings of EACL '99 Detection of Japanese...
  • 8
  • 588
  • 0
Tài liệu Management of Dead Bodies after Disasters: A Field Manual for First Responders docx

Tài liệu Management of Dead Bodies after Disasters: A Field Manual for First Responders docx

Cao đẳng - Đại học

... Tidball-BinzForensic Coordinator, Assistance Division, International Committee of the Red CrossDana van Alphen—Regional Advisor, Pan American Health Organization/World Health OrganizationWashington ... Implement a plan of action for the management of dead bodies.✴ Disseminate accurate information to families and communities about iden-tification of the missing and management of dead bodies.Effective ... Societies,have direct contact with affected communities and may act as a source of localinformation.♦ Aid workers are not always well informed and may give conflicting information,especially about...
  • 58
  • 450
  • 2
Báo cáo khoa học: The modulation of metal bio-availability as a therapeutic strategy for the treatment of Alzheimer’s disease pptx

Báo cáo khoa học: The modulation of metal bio-availability as a therapeutic strategy for the treatment of Alzheimer’s disease pptx

Báo cáo khoa học

... may therefore repre-sent a potential therapeutic strategy for preventingthe tau hyperphosphorylation and NFT formationcharacteristic of AD.Modulation of metal availability for treating AD ... ablated [41].Amyloid-bAfter the 4.5 kDa Ab peptide was identified as a major component of the amyloid plaques in AD brain[42,43], global AD research focused on this peptide as a causative agent ... olig-omerization, aggregation and fibrilization that Abforms amyloid plaques. As amyloid plaques are prom-inent in the postmortem AD brain, early research the-ories placed the accumulation of extracellular,insoluble...
  • 9
  • 634
  • 0
Báo cáo khoa học: Catalytically active membrane-distal phosphatase domain of receptor protein-tyrosine phosphatase a is required for Src activation doc

Báo cáo khoa học: Catalytically active membrane-distal phosphatase domain of receptor protein-tyrosine phosphatase a is required for Src activation doc

Báo cáo khoa học

... substrate, Src, and to dephosphorylate andactivate it.Materials and methodsMaterials and antibodiesAnti-HA-tag (12CA5), anti-Src (327) Igs and anti-RPTPa(5478AP) serum were prepared as previously ... following forward and reverse oligonucleotides:5Â- ATG AAG AAG AAC CAT GTT TTA CAG ATC -3Âand 5Â - GAT CTG TAA AAC ATG GTT CTT CTTCAT-3Â. The constructs encoding WT, R554H or C723SGST-PTPalpha D2 ... compared with that of wild-type(WT)-D2 and with that of D2-C723S, a catalyticallydead mutant with a mutation in the essential catalyticsite cysteine. The catalytic activity of D2-R554H wasdramatically...
  • 9
  • 289
  • 0
Báo cáo khoa học: Structure, epitope mapping, and docking simulation of a gibberellin mimic peptide as a peptidyl mimotope for a hydrophobic ligand pot

Báo cáo khoa học: Structure, epitope mapping, and docking simulation of a gibberellin mimic peptide as a peptidyl mimotope for a hydrophobic ligand pot

Báo cáo khoa học

... global measures of hydrophobiccore formation. Proteins 43, 1–11.11 Murata T, Fushinobu S, Nakajima M, Asami O, SassaT, Wakagi T & Yamaguchi I (2002) Crystal structure of the liganded anti-gibberellin ... Japan3 Department of Applied Biological Chemistry, Division of Agriculture and Agricultural Life Sciences, The University of Tokyo, JapanThe mimotope is a structure that acts as a mimic of anepitope ... STD-NMRspectra for epitope mapping were acquired using a series of equally spaced 50 ms Gaussian-shaped pulses for saturationwith 1 ms intervals and the total saturation time of  3s.The on-resonance...
  • 11
  • 565
  • 0
Determinants of General Health Status and Specific Diseases of Elderly Women and Men: A Longitudinal Analysis for Western and Eastern Germany doc

Determinants of General Health Status and Specific Diseases of Elderly Women and Men: A Longitudinal Analysis for Western and Eastern Germany doc

Sức khỏe người cao tuổi

... Demography of the AustrianAcademy of Sciences. Email: Christian.Wegner@oeaw.ac.atMarc Luy is Senior Scientist at the Vienna Institute of Demography of the Austrian Academy of Sciences. Email: Mark.Luy@oeaw.ac.at ... LES waves was associated with age and the presence of endocrine, nutritional and metabolic diseases at baseline. Increasing age was also associated with a higher likelihood of loss, as well as ... well as increased needs for social, medical and health care (Akker et al. 1998). We analysed multimorbidity as cumulative occurrence of heart diseases, cerebral vascular diseases, diseases of...
  • 61
  • 545
  • 0
Báo cáo khoa học: Distribution of the extrinsic proteins as a potential marker for the evolution of photosynthetic oxygen-evolving photosystem II ppt

Báo cáo khoa học: Distribution of the extrinsic proteins as a potential marker for the evolution of photosynthetic oxygen-evolving photosystem II ppt

Báo cáo khoa học

... Maruyama S,Takahara M, Miyagishima SY, Mori T, Nishida K,Yagisawa F, Nishida K, Yoshida Y et al. (2004)Genome sequence of the ultrasmall unicellular red algaCyanidioschyzon merolae 10D. Nature ... 8004–8012.4 Enami I, Murayama H, Ohta H, Kamo M, Nakazato K& Shen J-R (1995) Isolation and characterization of a photosystem II complex from the red alga Cyanidiumcaldarium: association of cytochrome ... haptophyte (P. gyrans) and brown algae(L. japonica and U. pinnatifida) in the red lineage reac-ted with antibody against red algal PsbQÂ but not withantibody against green algal and higher plant PsbQ(Fig....
  • 11
  • 501
  • 0
Báo cáo khoa học:

Báo cáo khoa học: "Demonstration of a prototype for a Conversational Companion for reminiscing about images" doc

Báo cáo khoa học

... that it can make sim-ple inferences from family relationships it al-ready knows (e.g. that daughters of the same par-ent are siblings) and that it can access real-time information about places ... feature adds an interesting ac-companiment to the photo domain and demon-strates the ability of the system to handle more than one kind of application at a time, and news has, of course, an ... unconstrained vocabulary. The following is a fairly typical example of its cur-rent capacity, depending of course on the images loaded, and comes from the middle part of a sample dialogue generated...
  • 6
  • 271
  • 0
Báo cáo Y học: Modeling the three-dimensional structure of H+-ATPase of Neurospora crassa Proposal for a proton pathway from the analysis of internal cavities pptx

Báo cáo Y học: Modeling the three-dimensional structure of H+-ATPase of Neurospora crassa Proposal for a proton pathway from the analysis of internal cavities pptx

Báo cáo khoa học

... H+-ATPase of Neurospora crassaProposal for a proton pathway from the analysis of internal cavitiesOlivier Radresa1, Koji Ogata2, Shoshana Wodak2, Jean-Marie Ruysschaert1and Erik Goormaghtigh11Service ... characterized by the formation of a covalent enzyme-aspartyl phosphate intermediate[2,3,42,43].The 3D structures of PMA1_NEUCR and of anotherP-type ATPase, the Ca2+-ATPaseofrabbitsarcoplasmicreticulum ... Neurospora crassa plasma-membraneH+-ATPase; ATC1_RABIT, Oryctolagus cuniculus (rabbit) Ca2+-ATPase of sarcoplasmic reticulum (splice isoform SERCA 1a) .(Received 27 May 2002, revised 23 A ugust...
  • 13
  • 514
  • 0
Proposal for a COUNCIL DIRECTIVE on a common system of financial transaction tax and amending Directive 2008/7/EC pot

Proposal for a COUNCIL DIRECTIVE on a common system of financial transaction tax and amending Directive 2008/7/EC pot

Tài chính doanh nghiệp

... N /A TOTAL appropriations for DG <…….> Payments =2+ 2a +3 N /A N /A N /A N /A N /A N /A N /A N /A Commitments (4) N /A N /A N /A N /A N /A N /A N /A N /A y TOTAL operational appropriations Payments ... N /A N /A N /A N /A TOTAL appropriations under HEADINGS 1 to 4 of the multiannual financial framework (Reference amount) Payments =5+ 6 N /A N /A N /A N /A N /A N /A N /A N /A Heading of multiannual ... respect of financial transactions carried out by that branch. Chapter II Chargeability, taxable amount and rates Article 4 Chargeability of FTT 1. The FTT shall become chargeable for each financial...
  • 31
  • 569
  • 0
Báo cáo khoa học: Investigations of the supercoil-selective DNA binding of wild type p53 suggest a novel mechanism for controlling p53 function doc

Báo cáo khoa học: Investigations of the supercoil-selective DNA binding of wild type p53 suggest a novel mechanism for controlling p53 function doc

Báo cáo khoa học

... subsequentaddition of 400 ng of scDNA (molar ratio p53 tetramer/DNA 5)and incubatio n of the samples on ice for 30 min. After elec trophoreticseparation in 1% agarose, DNA was stained with ... [8]. TheN-terminal domain contains a transactivation region[amino acids (aa) 1 –42] and a proline-rich region (aa61–94), and mediates interactions with other transcriptionfactors or the mdm2 ... Pivonkova1, Marie Brazdova1,2, Katerina Nemcova1, Jan Palecek1,3andBorivoj Vojtesek41Laboratory of Biophysical Chemistry and Molecular Oncology, Institute of Biophysics, Academy of Sciences...
  • 12
  • 265
  • 0
SAURASHTRA UNIVERSITY RAJKOT MASTER OF ARTS (ECONOMICS)CHOICE BASED CREDIT SYSTEM COURSE OF STUDIES SYLLABUS (A draft of CBCS courses in M.A., Economics submitted for Revision of Curriculum to be executed from ,June, 2010)ByDEPARTMENT OF ECONOMICS SA doc

SAURASHTRA UNIVERSITY RAJKOT MASTER OF ARTS (ECONOMICS)CHOICE BASED CREDIT SYSTEM COURSE OF STUDIES SYLLABUS (A draft of CBCS courses in M.A., Economics submitted for Revision of Curriculum to be executed from ,June, 2010)ByDEPARTMENT OF ECONOMICS SA doc

Cao đẳng - Đại học

... Economics Activities and Labour Market:Rural Industrialization scope and of agro-industries, economic condition of agricultural laborers –national Rural Employment Guarantee program, main characteristics, ... implementation mechanism, evaluation, lessons Rural and Agricultural programs and its evaluation in Gujarat, economic development and Social welfare oriented programs in Gujarat and its evaluation ... classical approach; Policy implications of new classical approach - empirical evidence. Approach of Mundell and other economists on open economy Asset Markets, Theory of Rational expectations...
  • 120
  • 449
  • 0
Báo cáo hóa học:

Báo cáo hóa học: " Optimization of capsid-incorporated antigens for a novel adenovirus vaccine approach" doc

Hóa học - Dầu khí

... NSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAA53RGD motif- SGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQ63RGD motif- SNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQPEVEK73RGD motif- GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQPEVEKPQKKP83RGD ... GGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQPEVEKPQKKP83RGD motif- TEQGGGGAGGSNSSGSGAEENSNAAAAAMQPVEDMNDHAIRGDTFATRAEEKRAEAEAAAEAAAPAAQPEVEKPQKKPVIKPLCore Arg-Gly-Asp (RGD) ... CGGGATCCGCCGCGGCAATGCAGCC43RGD -(as) CGGGATCCGGCAGCTTCGGCCGCTG43RGD - (a) CGGGATCCAACTCCAACGCGGCAGCC53RGD -(as) CGGGATCCTTGCGCAGCGGGGGC53RGD - (a) CGGGATCCAGCGGCGCGGAAGAGAACTC63RGD -(as) CGGGATCCCTTCTCGACCTCGGGTTGCG63RGD...
  • 13
  • 419
  • 0
Báo cáo hóa học:

Báo cáo hóa học: " The equiconvergence of the eigenfunction expansion for a singular version of onedimensional Schrodinger operator with explosive factor" pptx

Hóa học - Dầu khí

... research center of AlexandriaUniversity.Author details1Department of Mathematics, Faculty of Education, Alexandria University, Alexandria, Egypt2Faculty of IndustrialEducation, Helwan University, ... AH Nasser2* Correspondence: zaki55@Alex-sci.edu.eg1Department of Mathematics,Faculty of Education, AlexandriaUniversity, Alexandria, EgyptFull list of author information isavailable at ... of 11 RESEARCH Open AccessThe equiconvergence of the eigenfunctionexpansion for a singular version of one-dimensional Schrodinger operator with explosivefactorZaki FA El-Raheem1*and AH...
  • 11
  • 260
  • 0
Báo cáo hóa học:

Báo cáo hóa học: " The equiconvergence of the eigenfunction expansion for a singular version of onedimensional Schrodinger operator with explosive factor" potx

Hóa học - Dầu khí

... Education, AlexandriaUniversity, Alexandria, EgyptFull list of author information isavailable at the end of the articleAbstractThis paper is devoted to prove the equiconvergence formula of the ... version of one-dimensional Schrodinger operator with explosivefactorZaki FA El-Raheem1*and AH Nasser2* Correspondence: zaki55@Alex-sci.edu.eg1Department of Mathematics,Faculty of Education, ... Faculty of Education, Alexandria University, Alexandria, Egypt2Faculty of IndustrialEducation, Helwan University, Cairo, EgyptAuthors’ contributionsThe two authors typed read and approved...
  • 11
  • 268
  • 0

Xem thêm

Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ đặc tuyến mômen quay m fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25