cisco network academy program ccnp version 5 0
Tài liệu Ideas to help you when implementing Best Practices in the Cisco Network Academy Program pdf
... in the Cisco Network Academy Program Best Practices Challenges Description: Challenges are problem-based labs or projects, advocated by AAAS Project 206 1 (a ... following two LAN technologies for use in a high school environment on a limited budget: 10BASE-T Ethernet and 100 BASE-TX Fast Ethernet (Sem 1 and Sem 3). • Compare the following two WAN technologies ... of connections to other content. For networking students, a presentation provides experience in explaining a design, a project, or a solution. As a networking associate, this practice will...
- 36
- 406
- 0
Tài liệu Chapter 5 - OSI Network Layer CCNA Exploration version 4.0 ppt
... into Networks• Reasons for grouping devices into sub-networks and define several terms used to identify the sub-networks– GeographicHọc viện mạng Bách khoa - Website: www.bkacad.com 27 Network ... destination within a network or on another network with minimum overhead. • Reasons for grouping devices into sub-networks and define several terms used to identify the sub-networks– OwnershipGrouping ... www.bkacad.com 39 Network Layer Protocols and Internet Protocol (IP)Học viện mạng Bách khoa - Website: www.bkacad.com 3• Define the basic role of the Network Layer in data networks• The protocols...
- 64
- 414
- 0
Cisco Secure PIX Firewall Advanced Version 4.0
... deny 0 0 eq jave pix(config)#apply (inside) 1 outgoing_src B. pix(config)#outbound 1 deny 0. 0 .0. 0 0. 0 .0. 0 java pix(config)#apply (inside) 1 outgoing_src C. pix(config)#outbound 1 deny 0. 0 .0. 0 ... King(config)#interface ethernet4 100 full King(config)#ip address tess 172.19.4.1 255 . 255 . 255 .0 QUESTION NO: 100 Type the command that reboots the PIX Firewall. Answer: reload 9E0 - 111 Leading ... NO: 30 What is the command to enable a PIX Firewall to inspect port 55 4 for RTSP traffic? A. fixup protocol rtsp 55 4 B. inspect rtsp 55 4 C. fixup rtsp 55 4 D. inspect protocol rtsp 55 4 ...
- 103
- 574
- 1
Cisco Secure PIX Firewall Advanced Version 7.0
... Reference: Cisco PIX 50 0 Series Firewalls - Cisco PIX Firewall Software v5.2 http://www .cisco. com/en/US/products/hw/vpndevc/ps 203 0/products_data_sheet09186a 00 800 91b32.html QUESTION NO: 35 Why ... time. Reference: Cisco PIX 50 0 Series Firewalls - PIX 53 5 http://www .cisco. com/en/US/products/hw/vpndevc/ps 203 0/products_installation_guide_chapter09186a 008 017279e.html 9E0 - 111 Leading ... deny 0 0 eq jave pix(config)#apply (inside) 1 outgoing_src B. pix(config)#outbound 1 deny 0. 0 .0. 0 0. 0 .0. 0 java pix(config)#apply (inside) 1 outgoing_src C. pix(config)#outbound 1 deny 0. 0 .0. 0...
- 122
- 1,090
- 2
CCIE Pre-Qualification Test for Security Version 5.0
... router ospf 1 network 108 .3. 100 .0 0 .0. 0. 255 area 6 network 108 .3.2 .0 0 .0. 0. 255 area 0 D. router ospf 1 network 108 .3. 100 .0 255 . 255 . 255 .0 area 6 network 108 .3.2 .0 255 . 255 . 255 .0 area 6 E. router ... router ospf 1 network 108 .3.1 .0 0 .0. 0. 255 area 6 network 108 .3. 100 .0 0 .0. 0. 255 area 6 network 108 .3.2 .0 0 .0. 0. 255 area 6 Answer: D Explanation: Networks 108 .3. 100 .0 and 108 .3.2 .0 using a ... 101 permit ip 20. 1.1 .0 0 .0. 0. 255 30. 1.1 .0 0 .0. 0. 255 access-list 101 permit ip 20. 1.1 .0 0 .0. 0. 255 40. 1.1 .0 0 .0. 0. 255 D. crypto map foo 10 ipsec-isakmp set peer B match address 101 set trans...
- 167
- 526
- 0
Tài liệu Developing XML Web Services and Server Components with Microsoft Visual Basic .NET MCSD/MCAD/MCDBA Version 5.0 pptx
... Which version of the remote objects will MyApp activate? A. version 1 .0. 0 .0 of TK1; version 1 .0. 0 .0 of TK2 B. version 1 .0. 0 .0 of TK1; version 2 .0. 0 .0 of TK2 C. version 2 .0. 0 .0 of TK1; version ... TK2 C. version 2 .0. 0 .0 of TK1; version 1 .0. 0 .0 of TK2 D. version 2 .0. 0 .0 of TK1; version 2 .0. 0 .0 of TK2 Answer: B Explanation: Version 1 .0. 0 .0 of TK1 is used since the following client-activated ... Size property of the connectionString to 50 . All 50 connections are now in use. However, a request for connection number 51 is received. 07 0 - 3 10 Leading the way in IT testing and...
- 132
- 582
- 0
Tài liệu Cisco Network Administration Certification Guide_ CNA 5 ppt
... YROXPH7KHDWWULEXWHWRNHHSILOHVIURPEHLQJPLJUDWHGLV&apos ;0 ±'RQ¶W0LJUDWH 0$ 3FRPPDQGRSWLRQV 0$ 3'LVSOD\VDOLVWRIFXUUHQWGULYHPDSSLQJV 0$ 3 ; 6 (59 (5 ?6<60DSVWKH;GULYHWRWKH6<6YROXPHRQ6 (59 (5 FUHDWHVDQ$;7ILOH±$SSOLFDWLRQ2EMHFW7H[W7HPSODWH7KH$27LVLQELQDU\IRUPDWDQGFDQQRWEHHGLWHG7KH$;7FDQEHHGLWHG7KLV$27FDQEHFRQILJXUHGLQDQ$SSOLFDWLRQREMHFWDQGUROOHGRXWWRZRUNVWDWLRQVZKHUHWKHDSSOLFDWLRQZLOOEHLQVWDOOHG,WDOVRKDVDYHULILFDWLRQSURFHVVVRWKDWLIDILOHDVVRFLDWHGZLWKWKHDSSOLFDWLRQEHFRPHVGHOHWHGRUFRUUXSWLWZLOOUHLQVWDOOWKH$27 ... XVHUVDVSHFW7KH7UXVWHHVRIWKLV'LUHFWRU\SDJHLVXVHGWRDVVLJQULJKWVIURPDGLUHFWRU\VDVSHFW 0$ 316 (59 (5 ?6<60DSVWKHQH[WDYDLODEOHGULYHWRWKH6<6YROXPHRQ6 (59 (5 0$ 3 '(/;'HOHWHVWKHGULYHPDSSLQJWR; 0$ 3 6 6<66<67 (0 0DNHVWKH6<66<67 (0 GLUHFWRU\WKHVHFRQGVHDUFKGULYH 0$ 3 ... LPSRUWZRUNVWDWLRQVLQWRWKH1'6DQGWRPDQDJHDQGPDLQWDLQQHWZRUNDSSOLFDWLRQV&RPPDQGVDQG,GHQWLILHUV/RJLQVFULSWVKDYHWZRFRPSRQHQWVFRPPDQGVDQGLGHQWLILHUYDULDEOHV&RPPDQGV 0$ 3 &UHDWHVGULYHOHWWHUVWRSRLQWWRGLUHFWRULHVLQWKHILOHV\VWHP 5( 0 5( 0 $5. &RPPHQWLQJRXWDOLQH±WKHORJLQVFULSWLJQRUHVDQ\WKLQJDIWHUDUHPDUN([DPSOH 5( 0 0$ 3)...
- 20
- 495
- 1
Tài liệu TestKing''''s Designing Cisco Network Service Architectures Exam Version 4.1 doc
... A. 2 50 0 B. 300 0 C. 50 00 D. 6 50 0 Answer: C QUESTION NO: 65 Which of the following is a web-browser based tool designed to provide administrative access for content networking? ... discovery. B. Set the MTU higher than 1 50 0 bytes. C. Turn off pre-fragmentation for IPSec. D. Set the MTU value to 1 400 bytes. Answer: C, D QUESTION NO: 50 642 - 871 Leading the way ... than 200 meters apart. All campus wiring is Category 5e 642 - 871 Leading the way in IT testing and certification tools, www.testking.com - 25 - A. Netsys B. CiscoAssure C. CiscoWorks...
- 102
- 413
- 1
Tài liệu Cisco Network Academy Program_ Practices docx
... following IOS statement so that it assigns 193.1.7 .5 as the static route for all packets on 199.4 .5. 0: ip route 193.1.7 .5 255 . 255 . 255 .0 199.4 .5. 0 (Sem2) Level 4 Analysis Analysis allows students ... You are troubleshooting the 5- router network. Distinguish between observable network symptoms and what problems you might infer are causing those symptoms. Level 5 Synthesis Synthesis allows ... Best Practices* Ideas to help you when implementing Best Practices in the Cisco Network Academy Program These rubrics provide a standard for learners. It...
- 36
- 346
- 0
Tài liệu Cisco Networking Academy Program: Engineering Journal and Workbook, Volume II, Second Edition ppt
... Access-list 101 permit tcp 10. 1.1 .0 0 .0. 0. 255 [student LAN] host 10. 1.2.13 [Mail server on Admin LAN] eq 25 (Outgoing mail – SMTP) Access-list 101 permit tcp 10. 1.1 .0 0 .0. 0. 255 [student LAN] host 10. 1.2.13 ... 64 ,51 2– 65, 5 35. ) 3. What is the router command sequence needed to implement IGRP on the school’s router? RouterName(Config)# router IGRP 6 455 0 RouterName(Config-Router) #network 10. 0 .0. 0 RouterName(Config-Router) #network ... collision domain and accesses the full 10, 100 , or 100 0 Mbps. 10 Mbps is usually referred to as Ethernet, 100 Mbps is called Fast Ethernet, and 100 0 Mbps is labeled Gigabit Ethernet. • Symmetric...
- 102
- 559
- 0
Tài liệu Cisco Networking Academy Program: Engineering Journal and Workbook, Volume I, Second Edition ppt
... IEEE 802 .3 specification include 10BASE2, 10BASE5, 10BASE-F, 10BASE-T, and 10Broad36. Physical variations for Fast Ethernet include 100 BASE-T, 100 BASE-T4, and 100 BASE-X. LAN (local-area network) ... EISA, and so on) • Network topology (bus, ring, star) • Medium type (UTP, STP, 10Base2, 10Base5, 10BaseF) • Transport speed (1 Mbps, 4 Mbps, 10 Mbps, 16 Mbps, 100 Mbps, 100 0 Mbps) ⇒ Set the ... Engineering Journal and Workbook, Vol. I, 2nd Ed. – Chapter 1 Copyright © 200 2 Cisco Systems, Inc. Cisco Networking Academy Program: Engineering Journal and Workbook, Volume I, Second Edition Engineering...
- 240
- 2,137
- 0
Tài liệu Cisco Secure Intrusion Detection Systems - Version 6.0 doc
... that communicates on UDP ports 600 0- 700 0. Which Cisco IDS signature micro-engine can be used to detect attempts to locate the servers? A. Atomic.IPOptions 9E0- 100 46 21certify.com A. ... Reference: Cisco Secure PIX Firewall (Ciscopress) page 89 21certify.com CISCO: Cisco Secure Intrusion Detection Systems (CSIDS) 9E0- 100 Version 6 .0 Jun. ... (Ciscopress) page 6 80 Q.28 Which Cisco IDS software update file can be installed on a IDS-42 10 Sensor? A. IDSMk9-sp-3 .0- 3-S 10. exe B. IDSMk9-sp-3 .0- 3-S 10. bin C. IDSMk9-sig-3 .0- 3-S 10. exe D. IDSk9-sp-3.1-2-S24.exe...
- 56
- 464
- 0
Tài liệu Cisco Networking Academy Program docx
... Access Server 2 50 0 See Cisco 2 50 0. Cisco Access Server 51 00 See Cisco 51 00 . ciscoBus controller See SP. Cisco Discovery Protocol See CDP. Cisco Extended Bus See CxBus. Cisco FRAD Cisco Frame ... 1-4 v 3 .0 – Glossary Copyright 200 3, Cisco Systems, Inc. Cisco 7 50 0 Any of the Cisco 7 50 0 series of routers, a high-end multiprotocol router platform designed for use in enterprise networks. ... DS-1 applications with 24 trunks. C - 30 CCNA 1-4 v 3 .0 – Glossary Copyright 200 3, Cisco Systems, Inc. Cisco LightStream 202 0 Cisco LightStream 202 0 Enterprise ATM switch. For campus and...
- 176
- 530
- 0
Tài liệu Cisco Secure PIX Firewall Advanced - Version 4.0 pptx
... deny 0 0 eq jave pix(config)#apply (inside) 1 outgoing_src B. pix(config)#outbound 1 deny 0. 0 .0. 0 0. 0 .0. 0 java pix(config)#apply (inside) 1 outgoing_src C. pix(config)#outbound 1 deny 0. 0 .0. 0 ... King(config)#interface ethernet4 100 full King(config)#ip address tess 172.19.4.1 255 . 255 . 255 .0 QUESTION NO: 100 Type the command that reboots the PIX Firewall. Answer: reload 9E0 - 111 Leading ... 0. 0 .0. 0 255 . 255 . 255 . 255 java pix(config)#apply (inside) 1 outgoing_src D. pix(config)#outbound 1 deny java pix(config)#apply (inside) 1 outgoing_src Answer: B QUESTION NO: 76 Network...
- 103
- 332
- 0
- cisco network academy program
- cisco network academy program ccnp version 6 0
- cisco network academy program ccna
- cisco network academy program tshoot
- cisco network academy program ccna exploration
- cisco network academy program ccna version 6 0
- cisco network academy program ccna exploration download
- cisco network academy program blogspot
- cisco network academy program ccna version 5 0 download
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các nguyên tắc biên soạn khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra đối với đối tượng giảng viên và đối tượng quản lí khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến dòng điện stato i1 fi p2 động cơ điện không đồng bộ một pha phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25