a new class of mesoscopic aggregates as a novel drug delivery system
Development and evaluation of a novel nanoparticulate delivery system of arsenic sulfides
... (ROS) and depletion of glutathione [Park MJ et al., 2005] Induction of apoptosis through depolarization of mitochondrial membrane, activation of caspase-9, caspase-3 and PARP [Akao Y et al., 1999] ... solution was utilized as a drug for pernicious anemia, asthma, psoriasis, pemphigus, and eczema As indicated in the British Pharmaceutical and Therapeutic Products Handbook edited by Martindale in ... and Isetting = A Peaks: 1, iAsIII2-; 2, iAsV2-; 3, MMAV2-; 4, DMA- 46 IX Chapter 2, Figure The electrophoregrams of the alkali extracts of realgar (1.5 ppm as As) (a) and orpiment (1.5 ppm as...
- 232
- 463
- 0
Development of novel drug delivery system lipid microemulsion of tributyrin
... Nutrition Pharmacia & Upjohn US and Canada Limethason Dexamethasone Steroid Palmitate Liple Alprostadil Mitsubishi Japan Pharmaceutical Vasodilator, Platelet Mitsubishi Inhibitor Japan Pharmaceutical ... 1999] Caspase is a key protease that becomes activated during the early stages of apoptosis [Salvesen and Dixit, 1997] Proteases and their activators are important mediators of cell death and suggest ... submicro-emulsions Trade Name Drug Indication Manufacturer Market Diazemuls Diazepam Sedative Pharmacia & Upjohn Worldwide Diprivan Propofol Anaesthetic Astra Zeneca Worldwide Intralipid N A Parenteral Nutrition...
- 213
- 357
- 0
Báo cáo y học: "Salivary gland derived peptides as a new class of anti-inflammatory agents: review of preclinical pharmacology of C-terminal peptides of SMR1 protein" pptx
... article as: Mathison et al.: Salivary gland derived peptides as a new class of anti-inflammatory agents: review of preclinical pharmacology of C-terminal peptides of SMR1 protein Journal of Inflammation ... function • Pancreatitis induced in mice by intravenous injection of caerulein was measured histologically, by determination of plasma amylase and lipase activity, and by immunoassays • In vitro and ex ... Braun M, Cardinali DP: Autonomic nervous system regulation of murine immune responses as assessed by local surgical sympathetic and parasympathetic denervation Acta Physiol Pharmacol Latinoam...
- 11
- 406
- 0
Báo cáo Y học: Endogenous cardiac glycosides, a new class of steroid hormones pot
... 29 Masugi, F., Ogihara, T., Hasegawa, T., Sagakuchi, K & Kumahara, Y (1988) Normalization of high plasma level of ouabainlike immunoreactivity in primary aldosteronism after removal of adenoma ... the ouabainresistant a1 subunit of Na+/K+-ATPase [93,94] As one of the factors associated with blunted natriuresis, saltsensitive Dahl rats have a mutation in the a1 subunit of Na+/K+-ATPase [95] ... salt-sensitive Dahl rats were exposed to an acute NaCl load, a transient increase in the plasma endogenous ouabain concentration was observed that was accompanied by a sustained increase in the level of endogenous...
- 9
- 651
- 0
Báo cáo khoa học: Methanoferrodoxin represents a new class of superoxide reductase containing an iron–sulfur cluster docx
... ATGAAGAAAAAATAAATAAGC-3¢; and mm0632rev, 5¢-ATGGTAGGTCTCAGCGCTGGCTTTCCAGACGCA TTTTTTGC-3¢ The gene mm0632 was cloned via BsaI restriction sites in plasmid pASK-IBA3 (IBA GmbH, Gottingen, Germany), ... flow cryostat.Themagneticfieldwascalibratedbyuseofastrongoraweak pitch standard The sample (300 lL; 10 mg protein mL)1) was either measured as isolated or after reduction by a few grains of sodiumdithionite ... Germany) Cloning, expression and purification The mm0632 gene was amplified by PCR, with chromosomal DNA of M mazei as template and the following primers: mm0632for, 5¢-ATGGTAGGTCTCAAATGATAGGAA ATGAAGAAAAAATAAATAAGC-3¢;...
- 10
- 539
- 0
Báo cáo hóa học: "PROJECTION ITERATIVE APPROXIMATIONS FOR A NEW CLASS OF GENERAL RANDOM IMPLICIT QUASI-VARIATIONAL INEQUALITIES" pdf
... set-valued quasi-complementarity problems, Acta Mathematicae [6] Applicatae Sinica 16 (1993), 396–405 [7] S S Chang and Y G Zhu, Problems concerning a class of random variational inequalities and ... refer to [2, 4] and the references therein Further, the recent research works of these fascinating areas have been accelerating the random variational and random quasi-variational inequality problems ... includes a number of classes of variational inequalities, complementarity problems, and quasi-variational inequalities as special cases (see, e.g., [1, 4, 5, 8, 10–13, 15, 17, 19, 20, 25] and the...
- 17
- 344
- 0
Báo cáo hóa học: " Erratum to “A New Class of Particle Filters for Random Dynamic Systems with Unknown Statistics”" pot
... emphasis on the topics of Bayesian analysis, sequential Monte Carlo methods, adaptive filtering, stochastic optimization, and their applications to multiuser communications, smart antenna systems, ... joined Depar´ tamento de Electronica e Sistemas, Universidade da Coru˜ a, where he became an Asn sociate Professor in July 2003 His research interests are in the field of statistical signal processing, ... the area of statistical signal processing, and his primary interests are in the theory of modeling, detection, estimation, and time series analysis, and its application to a wide variety of disciplines...
- 2
- 327
- 0
Báo cáo toán học: "A new class of q-Fibonacci polynomials" pot
... type a if and ony if u = al bl aj for some l ≥ Let for example n = 10 and u = ababba, then u = ababba = ab1 ab2 ba and therefore ψ(u) = aaaabba The weight of these words is 11 If u = ababaa then ... q (3.2 ) Remark Formula (3.2 ) has been proved by Shalosh B Ekhad and D Zeilberger [14] with a computer proof and by S O Warnaar [13] as a special case of a cubic summation formula in the form ... providing another simple proof of (3.2 ) Morse code sequences are finite sequences of dots (•) and dashes (−) We assume that a dot has length and a dash has length The number of all such sequences of...
- 15
- 300
- 0
Báo cáo y học: "Natural variation of HIV-1 group M integrase: Implications for a new class of antiretroviral inhibitors" pdf
... Watanabe W, Yamataka K, Watanabe Y, Ohata Y, Doi S, Sato M, Kano M, Ikeda S, Matsuoka M: Broad Anti-Retroviral Activity and Resistance Profile of a Novel Human Immunodeficiency Virus Integrase Inhibitor, ... Watanabe W, Yamataka K, Sato M, Kano M, Ikeda S, Matsuoka M: In vitro antiviral activity and resistance profile of a novel HIV integrase inhibitor JTK-303/GS-9137 ICAAC 2006 Low A, Mohri H, Markowitz ... each pair of mutations JRAND was calculated as the mean Jaccard similarity coefficient after 2,000 random rearrangements of the X or Y vector (containing or for presence or absence of a mutation)...
- 11
- 455
- 0
Báo cáo sinh học: "Comparisons of three polyethyleneimine-derived nanoparticles as a gene therapy delivery system for renal cell carcinoma" doc
... physic-chemical properties (size and charge) of each separate material, including PCFC-g-PEI and FA-PEAs, as well as the FA-PEAs: pVHL complexes Because PCFC-g-PEI and FA-PEAs are amphiphilic ... free FA-PEAs (data not shown) So far as FA-PEAs:pVHL complexes were concerned, as shown in Table 2, the particle size was 277.5 nm at the mass ratio (FA-PEAs versus pVHL) of 5, while the particle ... size of PEI:pVHL complexes was larger than the FA-PEAs:pVHL complexes obviously at same ratio Generally, the particle size of FA-PEAs:pVHL complexes was decreased along with the increase of the...
- 10
- 453
- 0
báo cáo hóa học:" Comparisons of three polyethyleneimine-derived nanoparticles as a gene therapy delivery system for renal cell carcinoma" pot
... physic-chemical properties (size and charge) of each separate material, including PCFC-g-PEI and FA-PEAs, as well as the FA-PEAs: pVHL complexes Because PCFC-g-PEI and FA-PEAs are amphiphilic ... free FA-PEAs (data not shown) So far as FA-PEAs:pVHL complexes were concerned, as shown in Table 2, the particle size was 277.5 nm at the mass ratio (FA-PEAs versus pVHL) of 5, while the particle ... size of PEI:pVHL complexes was larger than the FA-PEAs:pVHL complexes obviously at same ratio Generally, the particle size of FA-PEAs:pVHL complexes was decreased along with the increase of the...
- 10
- 306
- 0
Báo cáo y học: "Screening of an endothelial cDNA library identifies the C-terminal region of Nedd5 as a novel autoantigen in systemic lupus erythematosus with psychiatric manifestations" ppt
... interpretation of data MR carried out the ELISA experiments and participated in analysis of data CA performed the statistical analysis and the clinical associations AS participated in the analysis and ... used as second antibodies and incubated (100 µl/well) for hour at 20°C o-Phenylenediamine dihydrochloride (Sigma) was used as a substrate and absorbance was measured at 490 nm Means + standard ... Psychiatric Association; 1994 14 Margutti P, Delunardo F, Sorice M, Valesini G, Alessandri C, Capoano R, Profumo E, Siracusano A, Salvati B, Rigano R, et al.: Screening of a HUAEC cDNA library...
- 8
- 375
- 0
báo cáo hóa học: " Reduced inclination of cervical spine in a novel notebook screen system - implications for rehabilitation" docx
... changes in the intradiscal pressure (PID) It has been suggested that an increased PID may worsen the alimentary status of the intravertebral disc that might contribute to a faster advancing of ... performed the analysis and interpretation of the data MFS, SU, KV, SM, BK: Participation in the analysis of data, revision of the manuscript All authors read and approved the final manuscript Received: ... upwards and locked in place to allow a more extended position of the cervical spine The aim of the current study was to analyze characteristics of a note book with a variable extended screen system...
- 6
- 536
- 0
Báo cáo y học: " In-Silico docking of HIV-1 integrase inhibitors reveals a novel drug type acting on an enzyme/DNA reaction intermediate" pdf
... 21:5263-5267 Sato M, Motomura T, Aramaki H, Matsuda T, Yamashita M, Ito Y, Kawakami H, Matsuzaki Y, Watanabe W, Yamataka K, Ikeda S, Kodama E, Matsuoka M, Shinkai H: Novel HIV-1 integrase inhibitors ... di Sanità, Rome, Italy (intramural grant: BASTET: Bases for Assessment and Evaluation of Eradication Strategies), and by the Italian Ministry of Research and University, Rome, Italy (FIRB grant: ... 31:11233-11238 Bujacz G, Alexandratos J, Wlodawer A, Merkel G, Andrake M, Katz RA, Skalka AM: Binding of different divalent cations to the active site of avian sarcoma virus integrase and their effects...
- 15
- 343
- 0
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc
... thermophilus E coli A pernix 277 277 283 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... Toyobo (Osaka, Japan) Emulgen 911 was a gift from Kao Chemical (Tokyo, Japan) NADPH, NADH and NADP+ were purchased from Oriental Yeast (Tokyo, Japan) a- Cyano-4-hydroxycinnamic acid was obtained from ... purified protein was analyzed by MALDI-TOF-MS Peptide mass fingerprinting was used to search the NCBInr database using mascot The result of the mascot search suggested that the band was a protein encoded...
- 14
- 617
- 0
Development of controlled drug delivery systems using uniform nanoporous materials as matrices
... images of OPS-15 unencapsulated (a and b) and encapsulated with PAA (c and d) 150 Figure 7.6 Release profiles of BSA from: a- PAA-encapsulated OPS-15, at pH 1.2; b- PAA-encapsulated OPS-15, at ... volume and surface area, a higher loading amount of drugs can be achieved Additionally, these materials are easily fabricated and loaded with desired drugs By making use of above properties, it has ... FESEM images of S-15: a- before PAA encapsulation and bafter PAA encapsulation; and OPS-15: c- before PAA encapsulation and d- after PAA encapsulation 148 Figure 7.5 Plan-view and cross-sectional...
- 203
- 440
- 0
Chemical Aspects of Drug Delivery Systems pptx
... approval and clearance, and the constraints imposed by the nature of the various routes of administration available for drug delivery ROUTES OF ADMINISTRATION AND CLASSIFICATION OF DRUG DELIVERY SYSTEMS ... i.e gastrointestinal, ocular, nasal, oral, vaginal and rectal Theoretically, mucoadhesion could resolve several problems of controlled release drug delivery systems, Chemical Aspects of Drug Delivery ... covers some of the advances in the Chemical Aspects of Drug Delivery Systems New materials for drug delivery and targeting are reviewed and a representative range of excipients and delivery systems...
- 174
- 343
- 0
THE CHEMISTRY OF DRUG DELIVERY SYSTEMS (hoá học các hệ dẫn truyền thuốc)
... Low rate of absorption Higher drug bioavailability Low drug bioavailability Rapid onset of action Sustained-release approaches Constantly washed by saliva Relatively immobile More permeable drug ... by trained personel MUCOSAL DRUG DELIVERY Advantages: avoid the first-pass effect of drug cleareance ORAL MUCOSAL ROUTE Classification: Sublingual delivery Buccal delivery Local delivery ... Topical delivery ORAL DELIVERY (GASTROINTESTINAL ADMINISTRATION) ORAL DELIVERY (GASTROINTESTINAL ADMINISTRATION) Advantages: safest most convenient most economical Disadvantages: poorly absorption...
- 151
- 1,199
- 10
Báo cáo hóa học: " The application of carbon nanotubes in target drug delivery systems for cancer therapies" docx
... application of CNTs as the molecular transporter in drug delivery Page 14 of 22 Drug delivery targeted to lymphatic system Many cancers metastasize through lymphatic canal The drug delivery systems ... Solubilization of single-wall carbon nanotubes by supramolecular encapsulation of helical amylose J Am Chem Soc 2003, 125:4426-4427 Numata M, Asai M, Kaneko K, Bae AH, Hasegawa T, Sakurai K, Shinkai ... whereas MWCNTs generally have special surface areas of a few hundred square meters per gram The bundling of SWCNTs dramatically decreases the special surface area of most samples of SWCNT to approximately...
- 22
- 847
- 0
Báo cáo hóa học: " Combination of Polymer Technology and Carbon Nanotube Array for the Development of an Effective Drug Delivery System at Cellular Leve" pptx
... alginate as drug reservoir embedded into the platform Among polymers, alginate has several unique properties that have allowed it to be used as a matrix for the entrapment and/or delivery of a variety ... argon as sputtering gas) CNT Array: Properties, Imaging and Coating Alginate Thin Film Design, Production and Characterization Vertically aligned CNT arrays were provided from NanoLab, Inc (Newton, ... g/mol) was added to an alginate solution at a final concentration of 200 lg/mL BSA was used as ‘‘protein model’’, as its molecular weight is similar to that one of NGF (N1408 from Sigma, reconstituted...
- 6
- 485
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các nguyên tắc biên soạn khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến mômen quay m fi p2 đặc tuyến tốc độ rôto n fi p2 sự cần thiết phải đầu tư xây dựng nhà máy từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25