0
  1. Trang chủ >
  2. Luận Văn - Báo Cáo >
  3. Báo cáo khoa học >

Tài liệu Báo cáo khoa học: A point mutation in the ATP synthase of Rhodobacter capsulatus results in differential contributions of DpH and Du in driving the ATP synthesis reaction pptx

Tài liệu Báo cáo khoa học: A point mutation in the ATP synthase of Rhodobacter capsulatus results in differential contributions of DpH and Du in driving the ATP synthesis reaction pptx

Tài liệu Báo cáo khoa học: A point mutation in the ATP synthase of Rhodobacter capsulatus results in differential contributions of DpH and Du in driving the ATP synthesis reaction pptx

... A point mutation in the ATP synthase of Rhodobacter capsulatus results in differential contributions of DpH and Du in driving the ATP synthesis reaction Paola Turina and B. Andrea MelandriDepartment ... Rb. capsulatus are aHis173 and aGlu210 [27]. We haveintroduced the single point mutation aGlu210 fi Lys and have investigated detailed functional aspects of the ATP synthase in native membranes. ... atesobtained in the absence of a Du. In this case, the impairment of the ATP synthesis rates in th e mutant was higher thantwofold, especially in the low DpH range.Again, this latter comparison can...
  • 9
  • 580
  • 0
Tài liệu Báo cáo khoa học:

Tài liệu Báo cáo khoa học: "A Practical Solution to the Problem of Automatic Word Sense Induction" doc

... available in the MATLAB (MATrix LABoratory) programming language. After some testing with various similarity functions and linkage types, we finally opted for the cosine coefficient and single ... matrix. An appropriate algebraic method that has the capability to reduce the dimen-sionality of a rectangular or square matrix in an optimal way is singular value decomposition (SVD). As ... dissimilarities among the top 30 associations to palm are all in the upper half of the scale and not very distinct. The two expected clusters for palm, one relating to its hand and the other to its...
  • 4
  • 536
  • 0
Tài liệu Báo cáo khoa học: A kinetic model of the branch-point between the methionine and threonine biosynthesis pathways in Arabidopsis thaliana doc

Tài liệu Báo cáo khoa học: A kinetic model of the branch-point between the methionine and threonine biosynthesis pathways in Arabidopsis thaliana doc

... threoninebiosynthesis pathways in Arabidopsis thaliana (Fig. 1). The computer model was validated in vitro andusedtoexamine the branch -point kinetics in detail and to obtain insights into the kinetic controls of ... concentration of AdoMet with Jcystathioninedecreasing and JThrincreasing as the concentration of AdoMet wasincreased. Half changes in Jcystathionine and JThrareobtained for a concentration in AdoMet ... branch-points of Ó FEBS 2003 An Arabidopsis phosphohomoserine branch -point model (Eur. J. Biochem. 270) 4625 the aspartate-derived amino-acids pathway and aromaticamino-acids pathway in plant and in microorganisms...
  • 13
  • 906
  • 0
Tài liệu Báo cáo khoa học: A DExD⁄ H box RNA helicase is important for K+ deprivation responses and tolerance in Arabidopsis thaliana docx

Tài liệu Báo cáo khoa học: A DExD⁄ H box RNA helicase is important for K+ deprivation responses and tolerance in Arabidopsis thaliana docx

... proteins, CBL1 and CBL9, were thenidentified as calcium sensors in the differential regula-tion of abiotic stress responses, and in the ABA sig-naling and stress-induced ABA biosynthetic pathways,respectively, ... zeatin and cold treatments also increased the accumulation of AtHELPS mRNA in seedlings(Fig. S1), suggesting that additional roles of AtHELPSmight exist in Arabidopsis.Experimental proceduresPlant ... Temporal and spatial expression of AtHELPS. (A) The relative expression of the AtHELPS gene in shoots and roots at different devel-opmental stages, as revealed by real-time quantitative PCR analysis....
  • 11
  • 786
  • 0
Tài liệu Báo cáo khoa học: a-enolase: a promising therapeutic and diagnostic tumor target ppt

Tài liệu Báo cáo khoa học: a-enolase: a promising therapeutic and diagnostic tumor target ppt

... A, Milella M et al. (2009) An integratedhumoral and cellular response is elicited in pancreaticcancer by alpha-enolase, a novel pancreatic ductaladenocarcinoma-associated antigen. Int J Cancer ... it acts as a key protein in tumor metastasis, promoting cellularmetabolism in anaerobic conditions and driving tumorinvasion through plasminogen activation and extracel-lular matrix degradation. ... includ-ing fibrin, extracellular matrix components (laminin,fibronectin) and proteins involved in extracellularmatrix degradation (matrix metalloproteinases, such asMMP3) [47–50]. Binding of plasminogen...
  • 11
  • 721
  • 0
Tài liệu Báo cáo khoa học: A systems biology approach for the analysis of carbohydrate dynamics during acclimation to low temperature in Arabidopsis thaliana doc

Tài liệu Báo cáo khoa học: A systems biology approach for the analysis of carbohydrate dynamics during acclimation to low temperature in Arabidopsis thaliana doc

... biology approach for the analysis of carbohydrate dynamics during acclimation to lowtemperature in Arabidopsis thalianaThomas Na¨gele, Benjamin A. Kandel*, Sabine Frana*, Meike Meißner and Arnd ... 6-phosphate; 30% KOHwas added to the control of each assay. Reactions wereincubated for 30 min at 25 and 4 °C, and then at 10 minat 95 °C. Anthrone 0.2% in 95% H2SO4was added, and the samples ... and a simulta-nous reduction in hexose concentration, particularlyduring the initial period of cold exposure. Using RNAinterference-mediated inhibition of the dominating vac-uolar invertase...
  • 13
  • 707
  • 0
Tài liệu Báo cáo khoa học: A strategy for discovery of cancer glyco-biomarkers in serum using newly developed technologies for glycoproteomics ppt

Tài liệu Báo cáo khoa học: A strategy for discovery of cancer glyco-biomarkers in serum using newly developed technologies for glycoproteomics ppt

... proteins appearing in the dark gray area of the Venn diagram are thought to be relatively abundant in serum, and are primary candidates for further validation. Glycoproteinsfound in the pale gray ... glycosylation,glycan structural analysis systems, the bioinformaticscapability and the databases that we have developedover the years, and animal models of aberrant glyco-sylation and clinical samples, ... C, Yamaguchi I, Akinaga A, Kitano H,Yokoyama K, Satomura M, Kurosawa T, WatanabeM, Kawabata T, Chang W et al. (2009) Automatedimmunoassay system for AFP-L3% using on-chipelectrokinetic reaction...
  • 11
  • 854
  • 0
Tài liệu Báo cáo khoa học: a-Defensins increase lung fibroblast proliferation and collagen synthesis via the b-catenin signaling pathway doc

Tài liệu Báo cáo khoa học: a-Defensins increase lung fibroblast proliferation and collagen synthesis via the b-catenin signaling pathway doc

... b-catenin, suggesting that a- defensins activate the b-catenin signaling pathway. We then studied the role of the b-catenin signaling pathway in a- defensin-induced increases in the proliferation and ... leading toinactivation of GSK3b and accumulation ⁄ activation of b-catenin [17,18]. To determine whether a- defensin-induced collagen synthesis and the accumulation ⁄ acti-vation of b-catenin ... indicate that a- defensin-induced increases in lung fibroblast proliferation and collagen synthesis involve the b-catenin signaling pathway.Inhibition of b-catenin signaling pathway usingquercetin...
  • 12
  • 602
  • 0
Tài liệu Báo cáo khoa học: A role of miR-27 in the regulation of adipogenesis ppt

Tài liệu Báo cáo khoa học: A role of miR-27 in the regulation of adipogenesis ppt

... control was maintained in a standard incubator with 21% O2. The normoxia data are the same as shown in Fig. 1 and are included here for comparison. Expression of miR-2 7a and miR-27b at the indicated ... were treated as described in (A) . Total RNA wasprepared at the indicated times and subjected to quantitative real-time PCR analysis. The data shown are mean value ± standard errors of the mean from ... treatment with the differentiation cocktail containing insulin, dexamethasone, and IDM, as described in Experi-mental procedures. Total cellular RNA was prepared at the indicated time points....
  • 11
  • 848
  • 0
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... the synthesis of thermozeaxanthins and thermobiszeaxanthins, which are the main carotenoids of T. thermophilus [15]. The insertion of thermozeax-anthins and thermobiszeaxanthins into the cell ... electron acceptor, at 25 °C and atpH 7.4 in the presence of NADH as well as NADPH, the Kmvalue of the FNR for NADPH was about600-fold lower than that for NADH, and the Vmaxvalue of the FNR ... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK...
  • 14
  • 617
  • 0

Xem thêm

Từ khóa: tài liệu báo cáo khoa học bản chất của khủng hoảng kinh tế thế giới pdftài liệu báo cáo nghiên cứu khoa họctài liệu về báo cáo khoa họcbáo cáo khoa học công nghệ phục vụ nông nghiệp và phát triển nông thôn các tỉnh phía bắc 2006 2007 tài liệu phục vụ hội nghịbáo cáo khoa học tài chính côngbáo cáo khoa học số loài quý hiếm tại vườn quốc gia ba bểtai lieu bao cao thuc tap khoa co khitai lieu bao cao thuc tap tai khoa duoc benh vientai lieu bao cao thuc tap y si da khoabáo cáo khoa học ảnh hưởng của tuổi thu hoạch đến năng suất và chất lượng thức ăn của cỏ voi pennisetum purpureum cỏ ghi nê panicum maximum trồng tại đan phượng hà tây pptxtai lieu bao cao thuc tap tim hieu nhan cach mot hoc sinhbáo cáo khoa học về nghệ thuật trong lieu trai chi ditai lieu bao cao thuc tap tai khoa duoc benh vien hop lucđề tài báo cáo khoa họcđề tài báo cáo khoa học sinh họcNghiên cứu sự biến đổi một số cytokin ở bệnh nhân xơ cứng bì hệ thốngchuyên đề điện xoay chiều theo dạngGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitNGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN SLIDETrả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)Phát hiện xâm nhập dựa trên thuật toán k meansNghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chếNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngTìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tinSở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIXTổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)Kiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)Tăng trưởng tín dụng hộ sản xuất nông nghiệp tại Ngân hàng Nông nghiệp và Phát triển nông thôn Việt Nam chi nhánh tỉnh Bắc Giang (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtĐổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt namHIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀMTÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲ