0
  1. Trang chủ >
  2. Luận Văn - Báo Cáo >
  3. Báo cáo khoa học >

Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp strain 10d doc

Tài liệu Báo cáo khoa học: Two novel variants of human medium chain acyl-CoA dehydrogenase (MCAD) K364R, a folding mutation, and R256T, a catalytic-site mutation resulting in a well-folded but totally inactive protein pptx

Tài liệu Báo cáo khoa học: Two novel variants of human medium chain acyl-CoA dehydrogenase (MCAD) K364R, a folding mutation, and R256T, a catalytic-site mutation resulting in a well-folded but totally inactive protein pptx

... preventscatalysis. Indeed this residue has recently been studied in rat MCAD, where the arginine was mutated toalanine, lysine, glutamine and glutamic acid. The authors found that the lysine mutant ... to the puri-fied protein (assuming no major change in the extinc-tion coefficient of the bound cofactor in the case of the mutants) [15]. The peak absorbance ratios showedfirst of all that the ... Two novel variants of human medium chain acyl-CoAdehydrogenase (MCAD)K364R, a folding mutation, and R256T, a catalytic-site mutationresulting in a well-folded but totally inactive proteinLinda...
  • 9
  • 533
  • 0
Tài liệu Báo cáo khoa học:

Tài liệu Báo cáo khoa học: "Some Novel Applications of Explanation-Based Learning to Parsing Lexicalized Tree-Adjoining Grammars"" doc

... is a part of the language defined by the grammar. Parsing new sentences amounts to find- ing analogous explanations from the training sen- tences. As a special case of EBL, Samuelsson and ... description of the anchor and provides a domain of locality over which the anchor can specify syntactic and semantic (predicate-argument) constraints. Elementary trees are of two kinds - (a) INITIAL ... Some Novel Applications of Explanation-Based Learning to Parsing Lexicalized Tree-Adjoining Grammars" B. Srinivas and Aravind K. Joshi Department of Computer and Information Science...
  • 8
  • 388
  • 0
Tài liệu Báo cáo khoa học:

Tài liệu Báo cáo khoa học: "Detecting Novel Compounds: The Role of Distributional Evidence" potx

... signifiant improvementover the baseline (p < .05) and outperforms anyother feature combinations including any otherpairings with contextual information. The DT learner's performance ... relies heavily on taxonomic in- formation. The contextual features are straightfor-ward to obtain—all we need is a concordance of the candidate compound annotated with parts of speech.Table 6 ... stipulates the relation between a mod-ifier and its head. For example, the compoundsmetal tube, leather belt and tin cup are the result of a lexical rule that combines a noun denoting a substance and...
  • 8
  • 583
  • 0
Tài liệu Báo cáo khoa học:

Tài liệu Báo cáo khoa học: "Contrasting Multi-Lingual Prosodic Cues to Predict Verbal Feedback for Rapport" pptx

... manually created for the Span-ish and Arabic data. Manual annotation of a broadrange of nonverbal cues, including gaze, blink, headnod and tilt, fidget, and coverbal gestures, is under-way. ... at an av-erage of 13-30% of pausal intervals across the threelanguages. As a result, the substantial class imbal-ance and relative sparsity of listener verbal feedbackpresent challenges for ... in creating this corpus,and Danial Parvaz for the development of the Arabictransliteration tool. We are grateful for the insights of Susan Duncan, David McNeill, and Dan Loehr.This work was...
  • 6
  • 286
  • 0
Tài liệu Báo cáo khoa học:

Tài liệu Báo cáo khoa học: "Mining User Reviews: from Specification to Summarization Xinfan Meng Key Laboratory of Computational Linguistics " doc

... on the data and eval-uate the precision and recall. We also run the al-gorithms described in Hu and Liu (200 4a) on the same data as the baseline.From Table 2, we can see the precision of base-line ... reduce the features redundancy and pro-vide a conceptual view of extracted features, G.Carenini et al. (200 6a) enhances the earlier work of Hu and Liu (200 4a) by mapping the extractedfeatures into ... digi-tal camera and 2 notebook computers. To evaluateperformance of our algorithm on real-world data,we do not perform noise word filtering on thesedata. Then we have a human tagger to tag featuresin...
  • 4
  • 428
  • 0
Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... the synthesis of thermozeaxanthins andthermobiszeaxanthins, which are the main carotenoids of T. thermophilus [15]. The insertion of thermozeax-anthins and thermobiszeaxanthins into the cell ... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... electron acceptor, at 25 °C and atpH 7.4 in the presence of NADH as well as NADPH, the Kmvalue of the FNR for NADPH was about600-fold lower than that for NADH, and the Vmaxvalue of the FNR...
  • 14
  • 617
  • 0
Tài liệu Báo cáo khoa học: Properties of ecdysteroid receptors from diverse insect species in a heterologous cell culture system – a basis for screening novel insecticidal candidates docx

Tài liệu Báo cáo khoa học: Properties of ecdysteroid receptors from diverse insect species in a heterologous cell culture system – a basis for screening novel insecticidal candidates docx

... S1. Amino acid alignment of linker region andligand-binding domain (LBD) of ecdysone receptors.Fig. S2. Amino acid alignment of linker region andligand-binding domain (LBD) of ultraspiracle ... immunoblot images. The pixel intensity of the bandsignal was determined for the defined band area and adjustedrelative to one of the signals, as designated, to calculate the relative band density.Vector ... candidate insecticidal compounds showing bothinductive and potentiative activity.Results The DNA-binding domains (DBDs) of Leptinotarsaand Drosophila EcR and USP are identical at everyamino...
  • 12
  • 627
  • 0
Tài liệu Báo cáo khoa học: Isolation and molecular characterization of a novel D-hydantoinase from Jannaschia sp. CCS1 docx

Tài liệu Báo cáo khoa học: Isolation and molecular characterization of a novel D-hydantoinase from Jannaschia sp. CCS1 docx

... Interestingly, annotation of the DNAsequences flanking the Jannaschia sp. CCS1 HYDJsrevealed an ORF encoding a putative allantoate amido-hydrolase, which is part of the urate catabolic pathway in ... USA4 Institut Pasteur of Shanghai, Chinese Academy of Sciences, Shanghai, ChinaOptically pure d-orl-amino acids are used as inter-mediates in several industries. d-amino acids areinvolved in the ... evolution andstructural analysis of N-carbamoyl-d-amino acid amidohydrolase provide insights into recombinantY. Cai et al. A novel high-activity D-hydantoinase from Jannaschia sp. CCS1FEBS Journal...
  • 14
  • 621
  • 0
Tài liệu Báo cáo khoa học: TransLISA, a novel quantitative, nonradioactive assay for transcription factor DNA-binding analyses pdf

Tài liệu Báo cáo khoa học: TransLISA, a novel quantitative, nonradioactive assay for transcription factor DNA-binding analyses pdf

... thusconfirm that the assay specifically measures HSF1DNA-binding activity.Analytical range and precision The analytical range of the assay was evaluated usingknown concentrations of recombinant human ... temperature. Assay procedure The assay was run as a three-step assay: initial incubation of the sample and probe, addition and incubation of the sampleand acceptor beads in the plate wells, and addition ... Biotin-TCGACTAGAAGCTTCTAGAAGCTTCTAGHSE antisense AGCTGATCTTCGAAGATCTTCGAAGATMutated HSEsenseBiotin-TCGACTTCAAGCTTGTACAAGCTTGTAGMutated HSEantisenseAGCTGAAGTTCGAACATGTTCGAACATC‘Scrambled’oligonucleotideBiotin-AACGACGGTCGCTCCGCCTGGCT140406080100120Counts...
  • 9
  • 457
  • 0
Tài liệu Báo cáo khoa học: Verprolin function in endocytosis and actin organization Roles of the Las17p (yeast WASP)-binding domain and a novel C-terminal actin-binding domain doc

Tài liệu Báo cáo khoa học: Verprolin function in endocytosis and actin organization Roles of the Las17p (yeast WASP)-binding domain and a novel C-terminal actin-binding domain doc

... WASP)-binding domain and a novel C-terminal actin-binding domainThirumaran Thanabalu1,2, Rajamuthiah Rajmohan2, Lei Meng2, Gang Ren4,5, Parimala R. Vajjhala4and Alan L. Munn1,3,4,6*1 Institute ... used in each binding assay and an amount representing 10% of the load used in each binding assay isshown (right). The lower panel shows GST only and the GST fusion proteins used to coat the beads ... in Table 2. The rabbit polyclonal GFP-spe-cific antiserum was a gift from J. Kahana and P. Silver(Dana Farber Cancer Center, Boston, MA). The anti-actinmAb was MAB1501 from Chemicon International...
  • 23
  • 679
  • 0

Xem thêm

Từ khóa: tài liệu báo cáo khoa học bản chất của khủng hoảng kinh tế thế giới pdftài liệu báo cáo nghiên cứu khoa họctài liệu về báo cáo khoa họcbáo cáo khoa học công nghệ phục vụ nông nghiệp và phát triển nông thôn các tỉnh phía bắc 2006 2007 tài liệu phục vụ hội nghịbáo cáo khoa học tài chính côngbáo cáo khoa học số loài quý hiếm tại vườn quốc gia ba bểtai lieu bao cao thuc tap khoa co khitai lieu bao cao thuc tap tai khoa duoc benh vientai lieu bao cao thuc tap y si da khoabáo cáo khoa học ảnh hưởng của tuổi thu hoạch đến năng suất và chất lượng thức ăn của cỏ voi pennisetum purpureum cỏ ghi nê panicum maximum trồng tại đan phượng hà tây pptxtai lieu bao cao thuc tap tim hieu nhan cach mot hoc sinhbáo cáo khoa học về nghệ thuật trong lieu trai chi ditai lieu bao cao thuc tap tai khoa duoc benh vien hop lucđề tài báo cáo khoa họcđề tài báo cáo khoa học sinh họcBáo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018Nghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoạiNghiên cứu vật liệu biến hóa (metamaterials) hấp thụ sóng điện tử ở vùng tần số THzNghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt namBiện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANPhối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọPhát hiện xâm nhập dựa trên thuật toán k meansNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngĐịnh tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)Tổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)Quản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)Tăng trưởng tín dụng hộ sản xuất nông nghiệp tại Ngân hàng Nông nghiệp và Phát triển nông thôn Việt Nam chi nhánh tỉnh Bắc Giang (Luận văn thạc sĩ)Nguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtGiáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtChiến lược marketing tại ngân hàng Agribank chi nhánh Sài Gòn từ 2013-2015HIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀMTÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲ