the brain in its direction
MANAGING WITH THE BRAIN IN MIND doc
... pain. Thosepeople who felt the most rejected had the highest levelsof activity in this region.” In other words, the feeling ofbeing excluded provoked the same sort of reaction in the brain ... from the blood, they are diverted from other partsof the brain, including the working memory function,which processes new information and ideas. Thisimpairs analytic thinking, creative insight, ... But in the brain, the ability to feel trust and empathy about others is shapedby whether they are perceived to be part of the samesocial group. This pattern is visible in many domains: in sports...
- 12
- 431
- 0
The Bible in its Making The most Wonderful Book in the World docx
... to them again, explaining that they must wait in patience, quietly doing their daily work, andearning their own bread, as he and his companions had done whilst living in Thessalonica. (2 Thessaloniansiii. ... learn the Law andserve God in His Temple. Matthew, therefore, was very learned in the books of the Law, and in the writings of the old prophets. As you all know, the Lord Jesus chose Matthew ... 'writing in pictures.' This was a very special kind of writing in ancientEgypt, and generally kept for important occasions. The lines in the middle give the same words, but in the ordinary...
- 63
- 374
- 0
Báo cáo y học: "ntravenous transplantation of allogeneic bone marrow mesenchymal stem cells and its directional migration to the necrotic femoral head"
... distributed in the right hip joint. Subse-quently, MSCs migrated into almost all organs, and were uniformly distributed in the brain, lungs, heart, kidney, intestine, hip joints and other organs ... tissues including brain, lungs, heart, kidneys, intestine and bilateral hip joints of nude mice. In rabbits, at 6 w after intravenous transplantation, GFP labeled MSCs were noted in the lungs, ... present, there are a lot of labeling methods including GFP la-beling, Lacz labeling, BrdU labeling, Y chromosome labeling and DiI labeling. GFP protein is stable. GFP gene can be transfected into...
- 10
- 584
- 0
Tài liệu Báo cáo khoa học: Characterization of human deoxyribonuclease I gene (DNASE1) promoters reveals the utilization of two transcription-starting exons and the involvement of Sp1 in its transcriptional regulation ppt
... related proteins, as shown in Fig. 1B. Toevaluate whether the Sp1-binding site in the DNASE1distal promoter is crucial for expression, a mutatedbinding site was introduced into the )197H construct,resulting ... site, and the numbers in parentheses below the diagram show the position of the corresponding nucleotides relative to the transcription start site in exon 1. In the expression vector ex-pDN, the Kozak ... supershifted the DNA–protein complex in association with reduction in the amount of the complex (lane 9), suggesting that Sp1binds to the putative site in the region from )90 to)51 relative to the...
- 12
- 609
- 0
Tài liệu Báo cáo khoa học: A role for the intersubunit disulfides of seminal RNase in the mechanism of its antitumor action docx
... thusblocking protein synthesis and leading cells to death. The current model proposed for the mechanism of antitumouraction of BS-RNase is based on the ability of the proteinto resist the neutralizing ... with the protein disulfides are located in the plasma membrane. Furthermore, they show that, asproposed in the hypothesis above, the RNase monomers arelinked through disulfides to the cell membrane, ... hypothesize that the cytotoxicactivity of the latter monomers was due to the presence in these proteins of disulfide bonds, with their potentialchemical instability. It is well known that in the...
- 8
- 604
- 0
Tài liệu Báo cáo khoa học: Key role of the loop connecting the two beta strands of mussel defensin in its antimicrobial activity docx
... moleculecomprising Ôresidues in the protruding domain consistingof the type VI b-turn and the first part of b-strand 3Õ (i.e. the b-hairpin loop and part of the adjoining b-sheet) andÔresidues in the loop ... in two discretedomains, led to the hypothesis that the positive clustercould initially dock the molecule onto the phospholipidsand that the surrounding hydrophobic cluster couldinitiate the ... using the CLUSTAL X(1.8) algorithm on the PFAM arth-ropod defensin family. The boxed parts indicate the sequences com-prised between the half-cystines forming the b-strand loop of defensins.Characters...
- 9
- 598
- 0
THE BUSINESS CAREER IN ITS PUBLIC RELATIONS potx
... Nearly all the individual works in the collection are in the public domain in the United States. If an individual work is in the public domain in the United States and you are located in the United ... going into business, let it be borne in mind that there are scientific principles underlying every branch of law, medicine, and the ministry in the list of the professions; that is to say, in ... are finding out and admitting the demand that present-day conditions impose, and are training many men in the pursuit of modern science, while they are training many others in the understanding...
- 37
- 401
- 0
Báo cáo khoa học: Binding of cGMP to the transducin-activated cGMP phosphodiesterase, PDE6, initiates a large conformational change involved in its deactivation ppt
... [3H]cGMPbinding with a Kd 50 nM and Pc inhibits the [3H]cGMP binding. Bindingof cGMP to Pabc is suppressed during its formation, implying that cGMPbinding is not involved in Pabcc activation. ... mutant in which18 amino acids in the N-terminus were deleted), N22del (aPc mutant in which 22 amino acids in the N-terminus weredeleted), C18Sub (a Pc mutant in which 18 amino acids in the C-terminus ... homogenates areincubated with GTPcS, the Pab content in membranesis increased 20–30% by binding of the Pab ⁄ Pc com-plex existing in the soluble fraction [13]. Therefore,binding of the Pab ⁄ Pc...
- 19
- 406
- 1
Dynamic Planet Mercury in the Context of Its Environment docx
... determining the moments of inertia of the principal axes. If a liquid layer, such as an outer core, decouples the inner core from the crust, then the moment of inertia of the crust may be determined ... and Figure 2-2. Mariner 10 spacecraft, illustrating the spacecraft design described in the text: The instrument package, including cameras boom mounted instruments, including the magnetometer, ... sensors were mounted on the tips of the solar panels.Simple thermal protection strategies involved: insulating the interior of the spacecraft, top and bottom, using multi-layer thermal blankets and...
- 239
- 390
- 0
The Green House - New Directions in Sustainable Architecture pdf
... 49!NEXCEPTIONTOTHATRULEIS"ATTERY0ARK#ITYONEOF.EW9ORKSMOSTPROGRESSIVEURBANPLANNINGVENTURESINTHEPASTTHREEDECADES"UILTONACRESOFLANDẵLLCREATEDBYEXCAVATINGTHE7ORLD4RADE#ENTERSITEINTHESTHEMIXEDUSEDEVELOPMENTHUGG IN GTHESOUTHWESTERNEDGEOF-ANHATTANHASFUNCTIONEDASALABORATORYFORANEWAPPROACHTOURBANLIVINGONETHATCOMBINESPROXIMITYTOCULTUREANDCOMMERCEWITHAMENITIESAVAILABLETOFEW.EW9ORKERSHARBORVIEWSAMARINAANDẵNELYLANDSCAPEDPARKSEMBELLISHEDWITHPUBLICART/NEOFITSBOLDESTEXPERIMENTSWASESTABLISHINGINASETOFENVIRONMENTALGUIDELINESREQUIRINGALLNEWHOUSINGTOBEAPPRECIABLYAHEADOFCURRENTSTANDARDSANDPRACTICESFORDEVELOPMENT4HE3OLAIREASTORYAPARTMENTBUILDINGATTHESOUTHERNTIPOFTHEDEVELOPMENTISTHEẵRSTRESIDENTIALTOWERIN.EW9ORKTOSYSTEMATICALLYEMBRACESUSTAINABLEDESIGNANDTHEẵRSTTOCOMPREHENSIVELYSATISFY"ATTERY0ARK#ITYSGREENGUIDELINES)THINKOFTHE3OLAIREASAGREATBIGGUINEAPIGENTHUSESPROJECTARCHITECT2AFAEL0ELLIAPRINCIPALAT#ESAR0ELLI!SSOCIATES)TWILLEDUCATEANINDUSTRYACROSSABIGSECTORANDEDUCATIONISAHUGEPARTOFBRINGINGSUSTAINABLEBUILDINGPRACTICESINTOTHEMAINSTREAM0ELLIWHOGREWUPWATCHINGHISFATHERARCHITECT#ESAR0ELLIDESIGNTHEMASTERPLANANDSEVERALBUILDINGSFOR"ATTERY0ARK#ITYANDHISMOTHERLANDSCAPEARCHITECT$IANA"ALMORICREATEPARKSANDURBANGARDENSDEVELOPEDANEARLYINTERESTINSUSTAINABLEDESIGN!FTERJOININGHISFATHERS.EW(AVEN#ONNECTICUTBASEDPRACTICEINHEOPENEDTHEẵRMS.EW9ORK#ITYOFẵCEIN4HE3OLAIRECOMMISSIONALSOCAMEINFOLLOWINGTHEANNOUNCEMENTOFTHENEWGUIDELINES&ROMTHESTARTONEOFTHEBIGGESTCHALLENGESFOR0ELLIANDHISTEAMWASTRANSLATINGWHATTHEYKNEWASGENERALPRINCIPLESOFSUSTAINABLEBUILDINGMETHODSINTOSPECIẵCDESIGNDECISIONS4HEREISAHUGEGAPBETWEENTHETECHNOLOGYTHATEXISTSANDWHATISACTUALLYAVAILABLEFROMMANUFACTURERSSAYS0ELLI&OREXAMPLETHEPHOTOVOLTAICCELLSTHATẵTTHEBUDGETCAMEONLYINBLUENOTTHEORIGINALLYSPECIẵEDCHARCOALCOLOR5LTIMATELY0ELLIEMBRACEDTHEBLUETILESTHEIRLIVELYLIGHTREắECTINGSURFACESCREATEASTIPPLEDQUALITYTHATWORKSWELLWITHTHEBUILDINGSTAUTSKINFACADE/THERDECISIONSWEREDICTATEDBYTHETEAMSSELFIMPOSEDCOMMITMENTTOWORKINGWITHLOCALMANUFACTURERSHALFOFALLMATERIALSUSEDINTHECONSTRUCTIONWEREPROCUREDLOCALLYANDANOTHERẵFTHHADTOBEMANUFACTUREDWITH IN MILES0ELLISTEAMWENTTOGREATLENGTHSTOMAKETHERIGHTENVIRONMENTALCHOICESATEVERYSTAGE-ATERIALSANDSYSTEMSWERETESTEDANDDESIGNSREVISEDACCORDINGLY!PLANFORBAMBOOắOORINGWASSCRAPPEDWHENTHEADHESIVEBACKINGWASDETERMINEDTOBETOXIC.EWINSULATIONWASADDEDAFTERANELABORATEWALLMODELBUILTFULLSCALEANDTESTEDINAWINDTUNNELATTHEDEVELOPERSEXPENSEINDICATEDTHATONEEXTRALAYEROFSEALANTCOULDMAKEAHUGEDIFFERENCEINTERMSOFLIMITINGAIRINẵLTRATION)TTURNEDOUTTOBEASIMPLESOLUTIONONEGUYWITHAGOOPGUNGOESINANDTHEWHOLETHINGISTAKENCAREOF0ELLISAYS"UTWITHOUTTHOSESTUDIESWEWOULDNEVERHAVEKNOWNITWASNECESSARY)NCORPORATINGALONGLISTOFSUSTAINABLETECHNOLOGIESTHE3OLAIRESURPASSESALLCURRENTENVIRONMENTALGUIDELINESINEFFECTIN.EW9ORK)TISPERCENTMOREEFẵCIENTTHANTHE3TATE%NERGY#ODEREQUIRES4HETOWERGENERATESPERCENTOFITSENERGYWITHTHEHELPOFSQUAREFEETOF7HILETHE-ANHATTANSKYLINEISFULLOFINSTANTLYRECOGNIZABLEICONSTHEDAYSWHENTHE"IG!PPLESTOODATTHEFORWARDEDGEOFARCHITECTUREARELARGELYINTHEPAST4HETALLESTSKYSCRAPERSARENOWRISING IN! SIAANDTHELATESTTECHNICALENGINEERINGINNOVATIONSAREMORELIKELYTOBEREALIZEDIN%UROPE5NTILTHEREDEVELOPMENTAT'ROUND:EROPROMPTEDARECENTSURGEOFPUBLICINTERESTINARCHITECTUREANDURBANDESIGNBOTTOMLINEPRESSURESANDPRESERVATIONSTRUGGLESTENDEDTODOMINATEDISCUSSIONSABOUTARCHITECTUREIN.EW9ORK#ITY:<&ACINGWESTACROSSTHE(UDSON2IVERATTHESOUTHERNTIPOF-ANHATTAN THE3 OLAIREHASEMBEDDEDPHOTOVOLTAICPANELSTHATCAPTURESUNLIGHTTHROUGHOUTTHEDAYANDEVENATDUSKABOVEASITBOUNCESOFFTHEWATERLOCATIONNew ... Design#ANADATHE5NITED3TATES*APANAND!USTRALIARESIDENTIALARCHITECTSARECOMBININGEYECATCHINGCONTEMPORARYARCHITECTUREWITHSUSTAINABILITY&ORABOOKTHATWEBELIEVEISTHEẵRSTOFITSKINDWESETOUTTOSELECTTHEẵNESTEXAMPLESOFTHISNEWCONắUENCEANDEXPLAINHOWEACHOFTHEMCAMEINTOBEINGWHOCOMMISSIONEDTHESEHOUSESANDAPARTMENTBLOCKSHOWTHEIRDESIGNSEVOLVEDANDHOWTHEIRARCHITECTSANDBUILDERSMANAGEDTOBALANCEENVIRONMENTALANDAESTHETICCONCERNSSOEFFECTIVELY4HEMOREWEBEGANTOSEARCHFORSUCHPROJECTSTHEMOREWEREALIZEDNOTJUSTHOWMANYAREOUTTHEREINDEEDWEENDEDUPWITHMOREQUALIẵEDPROJECTSTHANWEHADPAGESTOSHOWTHEMONBUTTHEREMARKABLEREGIONALANDARCHITECTURALVARIETYTHEYREPRESENT'REENHOUSESNOWRISEFROMTIGHTLYPACKEDCITYSTREETSASWELLASFROMLUSHHILLSIDESANDROCKYSEASHORES4HEYARESINGLEFAMILYDWELLINGSANDSUBSIDIZEDAPARTMENTSPRIMARYRESIDENCESANDWEEKENDGETAWAYS4HEYARESHEATHEDINGLASSINBAMBOOINSYNTHETICPANELSMADEFROMRECYCLEDNEWSPAPER4HEYTAKETHEIRAESTHETICCUESFROMPRIMITIVEDWELLINGSFROMORGANICFORMSANDSIGNIẵCANTLYFROMARCHITECTURALPREDECESSORSWHOINCLUDETHEFOUNDERSOFTHE"AUHAUSASSURELYAS0AOLO3OLERIOR&RANK,LOYD7RIGHT)NFACTITISBECOMINGIMPOSSIBLETOIGNOREHOWMANYGREENHOUSESARENOWBEINGDESIGNEDINTHESLEEKORNAMENTFREESTYLETHATHASONCEAGAINBECOMETHEPREVAILINGARCHITECTURALAPPROACHAMONGHIGHENDARCHITECTSPARTICULARLYYOUNGERONESIN!MERICAAND%UROPE&ORTHEẵRSTTIMEINTHEHISTORYOFTHEGREENDESIGNMOVEMENTSUSTAINABILITYISBEINGEMBRACEDBYTHEVERYSAMEARCHITECTSWHOSETTHEẵELDSSTYLISTICANDTHEORETICALAGENDAS)NADDITIONTO$IETRICH3CHWARZSCORNEROF3WITZERLANDOURSEARCHFORTHEHOUSESTHATẵLLTHEFOLLOWINGPAGESTOOKUSTOLOCATIONSALLAROUNDTHEWORLD/NTHEEDGEOF,AKE7ASHINGTONNEAR3EATTLEWEDISCOVEREDANEWHOUSEBYTHEWELLKNOWN0ACIẵC.ORTHWESTẵRM/LSON3UNDBERG+UNDIG!LLEN)TSDESIGNISANCHOREDBYACURVINGUSHAPEDWALLTHATISANENGAGINGSCULPTURALELEMENTANDBECAUSEITBOTHCONDUCTSCOOLAIRINTHESUMMERANDBOUNCESSUNLIGHTBACKINTOTHEINTERIORINWINTERTHEKEYTOITSREMARKABLEENERGYEFẵCIENCY$OWNTHECOASTIN-ARIN#OUNTY#ALIFORNIAWEMET-ICHELLE+AUFMANNWHOHADRECENTLYLEFTAJOBIN&RANK'EHRYSOFẵCETOSTARTHEROWNẵRM+AUFMANNHASDESIGNEDTHEMODULAR'LIDE(OUSETHEẵRSTMASSPRODUCEDGREENHOME)TCANBECUSTOMORDEREDANDTHENTRUCKEDDIRECTLYTOABUILDINGSITETOBECONSTRUCTEDINAMATTEROFWEEKSITISALREADYONTHEMARKETFORROUGHLYPERSQUAREFOOTABARGAINGIVENTHEHIGHQUALITYOFITSMATERIALSANDDESIGN!LITTLEFURTHERSOUTHWEWENTTOSEE#OLORADO#OURTAFORTYFOURUNITLOWINCOMEAPARTMENTCOMPLEXIN3ANTA-ONICADESIGNEDBYTHEWELLREGARDEDẵRM0UGH3CARPA/NTHEOPPOSITECOASTWEFOLLOWEDTHEPROGRESSOF2AFAEL0ELLISGREENAPARTMENTTOWERIN-ANHATTAN4HE3OLAIREISTHEẵRSTSUSTAINABLERESIDENTIALPROJECTOFITSSIZEORAMBITIONINAN!MERICANCITY!NDACOUPLEHOURSNORTHOF.EW9ORK#ITYWEDISCOVEREDTHAT3TEVEN(OLLAMUCHLAUDEDARCHITECTWHOSENAMEHASRARELYIFEVERBEENMENTIONEDINCONNECTIONWITHGREENDESIGNHADDESIGNEDANADDITIONTOHISOWNWEEKENDHOMETHATINCLUDESALONGLISTOFSUSTAINABLEELEMENTSFROMSOLARPANELSTOANINVENTIVENATURALVENTILATIONSYSTEM)N%UROPEWEFOUNDSUSTAINABLEDWELLINGSWITHALEVELOFARCHITECTURALANDENVIRONMENTALSOPHISTICATIONTHATPUTSMOSTGREENBUILDINGSIN THE5 NITED3TATESTOSHAME)TISWELLKNOWNTHATMANY%UROPEANCOUNTRIESHAVEBUILDINGCODESTHATPAYSIGNIẵCANTLYMOREATTENTIONTOISSUESOFSUSTAINABILITYTHANTHOSEINTHE5NITED3TATES,ESSREMARKEDUPONATLEASTINTHE!MERICANPRESSHASBEEN%UROPESSUBSTANTIALINVESTMENTINNEWHOUSINGTHATMEETSSTRINGENTSUSTAINABILITYBENCHMARKS#ITIESLIKE(ELSINKIAND3TOCKHOLMHAVEDEDICATEDHUGEANDVALUABLESWATHSOFLANDTOGREENDEVELOPMENTSSOMEOFWHICHCONTAINSEVERALTHOUSANDUNITSOFHOUSING.OTALLTHE%UROPEANPROJECTSTHATẵLLTHESEPAGESAREPUBLICLYSUBSIDIZEDTOBESURE/NASTEEPHILLSIDEOVERLOOKING3TUTTGARTWETOUREDTHEJAWDROPPING2ASTEELANDGLASSBOXDESIGNEDBYTHE'ERMANENGINEER7ERNER3OBEKASHISFAMILYRESIDENCE3INCETHEDAYSOF-IESVANDER2OHES&ARNSWORTH(OUSEIN0LANO)LLINOISANDITSSEETHROUGHSIBLINGIN.EW#ANAAN#ONNECTICUTBY0HILIP*OHNSONBOTHẵNISHEDAROUNDTHEGLASSHOUSEHASSTOODASTHEEPITOMEOFTHEMODERNISTAESTHETICUNFORTUNATELYSUCHDWELLINGSHAVEOFTENBEENBOTHUNCOMFORTABLETOLIVEINTOOHOTINSUMMERTOOCOLDINWINTERANDWITHTHEIRHIGHHEATINGANDCOOLINGBILLSANDINSENSITIVITYTOSITEHARDLYKINDTOTHEENVIRONMENTEITHER3OBEKSETHIMSELFTHESTIFFCHALLENGEOFSTARTINGWITHTHEFAMOUSTYPOLOGYOFTHEGLASSHOUSEANDTHENMAKINGITSUPREMELYENERGYEFẵCIENT(ISDESIGNHASCERTAINLYBEENASUCCESSINTHATREGARDDURING2BY7ERNER3OBEK ... EXPOSEDSTEELBEAMSCORRUGATEDMETALDECKINGATTHECEILINGSANDSMOOTHCONCRETEắOORSTHATDOWNPLAYTHEBUILDINGSENVIRONMENTALAGENDA7HENTHEIRWALLSIZEALUMINUMFRAMEDGLASSGARAGEDOORSAREROLLEDUPTHELOFTSTYLEINTERIORSTAKEONTHEFEELOFACOVEREDTERRACE3MALLBALCONIESANDALARGEROOFTOPGARDENPROVIDEADDITIONALOUTDOORACCESS4HE%AST5NION3TREETPROJECTISPARTOFAGROWINGTRENDTHATISLURINGSUBURBANITESBACKTOTHECITY4HEBUILDINGALSOREPRESENTSANEFFORTONTHEPARTOFTHEDEVELOPERTOBRINGSOMEOFTHEBEST%UROPEANDESIGNIDEASTOTHE5NITED3TATES&OREXAMPLESINCETHESQUAREFOOTPARCELWASTOOSMALLTOACCOMMODATETHEEIGHTPARKINGSPACESREQUIREDBYTHENUMBEROFHOUSINGUNITSINTHEBUILDINGTHEARCHITECTSINSTALLEDHYDRAULICPARKINGLIFTSTHATALLOWTWOMEDIUMSIZECARSTHESPACEISINTENTIONALLYTOOSMALLFOR356STOBESTACKEDVERTICALLYINASINGLESPACE%QUALLYINGENIOUSISTHEUSEOFTHEROOFASOUTDOORSPACE#ONẵGUREDASASERIESOFDECKSANDACCESSEDBYMETALSPIRALSTAIRCASESTHEROOFOFFERSPANORAMICVIEWSOF0UGET3OUNDANDTHE/LYMPIC-OUNTAINS:4HEẵVESTORYMIXEDUSELOFTBUILDING IN3 EATTLES0IKE0INEAREAHASALIMITEDNUMBEROFPARKINGSPACESANDISWITH IN WALKINGDISTANCEOFALIGHTRAILSTATION7HENFORMERHIGHTECHEXECUTIVE,IZ$UNNDECIDEDTOSTARTANEWCAREERSHEREVISITEDHEROLDDREAMOFBECOMINGANARCHITECT!FTERTAKINGAFEWCLASSESINARCHITECTUREURBANPLANNINGANDREALESTATEDEVELOPMENTATTHE5NIVERSITYOF7ASHINGTONSHEEMBARKEDONANAMBITIOUSPROJECTAREALESTATEVENTURETHATWOULDBLENDHIGHARCHITECTURALASPIRATIONSWITHENVIRONMENTALRESPONSIBILITY!LREADYACOMMITTEDENVIRONMENTALACTIVISTSHEWASPARTICULARLYCONCERNEDABOUTTHECULTURALCAUSESOFENVIRONMENTALDEGRADATIONESPECIALLYTHETENDENCYFORSUCCESSFULEXECUTIVESLIKEHERSELFFOREXAMPLETOCOMMUTETOWORKDAILYFROM$ISNEYESQUE-C-ANSIONSOUTSIDE3EATTLELOCATIONSeattle,...
- 197
- 2,277
- 1
Báo cáo khoa học: The properties of phosphodiesterase 11A4 GAF domains are regulated by modifications in its N-terminal domain pptx
... small-molecule-binding domains that have been identified in > 3000proteins throughout all taxonomic kingdoms [5,6]. The acronym GAF is derived from the proteins in whichthese domains were initially ... regulating the cGMP affinity of the PDE11A4 tandem GAFdomain and thus allosterically affect PDE11 activity. The role of the N-terminus of the PDE11A4 GAFtandem domain The N-termini that precede the ... N-ter-mini of GAF-domain-containing PDEs that mightcontribute to intramolecular signalling in a similarmanner. Another point merits discussion. Irrespectiveof phosphomimetic mutations or N-terminal...
- 8
- 326
- 0
Báo cáo khoa học: Intermonomer cross-linking of F-actin alters the dynamics of its interaction with H-meromyosin in the weak-binding state ppt
... producean increase in rotational motion in the environmentof the Cys374 site of actin [8]. In a recent publication the authors argue that in the weak binding state ofmyosin to actin the heads interact ... myosin and actin combine in a tight-bindingstate [24–26]. The transition from the intermediateweak-binding state to the strong-binding staterequires a conformational change, an intramolecularmotion ... restriction of the flexibility in cross-linked filaments. In the copolymers, subdomain 1,where the spin probe is attached, is not directlyinvolved in the intermonomer cross-link, because oneof the cross-linking...
- 10
- 311
- 0
EVERYTHING IN ITS RIGHT PLACE: FOUCAULT AND THE ''''IDEOLOGY OF THE AESTHETIC'''' pptx
... eminently clear by the intertwining of these themes in the writing collected in the Essential Works.32 Osborne's analysis of the conditions under which art criticism might be reimagined ... of the present establishes both the inadequacy of the 'art as aesthetics' thesis, and the ineliminability of the aesthetic dimension of artworks. Eagleton's The Ideology of the ... articulating aesthetic 29 Ibid., 311. 30 Ibid., 312. 31 Ibid., 315. 32 The interrelation of these domains is evident not least in the blurring of lines across the three volumes of the Essential...
- 13
- 351
- 0
Báo cáo khoa học: Amino acid residues on the surface of soybean 4-kDa peptide involved in the interaction with its binding protein potx
... & Tager, H.S. (1987) Role of the COOH-terminal B-chain domain in insulin–receptor interactions:identification of perturbations involving the insulin mainchain.J. Biol. Chem. 262, 12054–12058.20. ... to the solvent. Thissuggests that the aromatic residue, Phe28, plays a vitalrole in maintaining the hairpin-b during interaction withsolvent.Interaction of insulin with the 43-kDa proteinSimilarly ... of insulin–insulin receptor interaction, the areaconsisting of Ile25, Val29, Phe31 and Ile33 in the 4-kDapeptide should play a critical role in the interaction with the 43-kDa protein. These...
- 10
- 420
- 0
The Fungal Community Its Organization and Role in the Ecosystem Third Edition docx
... can then be tied to process levelmechanisms. In addition to determining the interface between resources and organisms, it is alsoessential to determine the location of the substrate and the ... function in soilsystems. Measurements of hyphal lengths can indicate the presence of a fungus at sometime in the past, or they can indicate the presence of an active fungus, depending on the techniques ... dynamics are notimportant to the organization and structure of terrestrial systems. Exploring the interactionsof fungi within the fungal community and their role in determining plant communities,especially...
- 966
- 771
- 0
- the use of the brain
- toward replacement parts for the brain
- the god in the box
- the thing in the attic
- the girl in the mirror
- is there a way to measure serotonin levels in the brain
- how adderall works in the brain video
- function of glial cells in the brain
- where is the source of the nile river in which direction does it flow and where is its delta
- the shortcomings of the standard economic model are in its portrayal
- given how the shortcomings of the standard economic model are in its portrayal
- cxcr4 cxcl12 in nonsmallcell lung cancer metastasis to the brain
- environmental problems in the philippines and its causes
- role of glial cells in the brain
- sex and the brain in classical conditioning
Tìm thêm: xác định các mục tiêu của chương trình khảo sát các chuẩn giảng dạy tiếng nhật từ góc độ lí thuyết và thực tiễn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản xác định thời lượng học về mặt lí thuyết và thực tế điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ lồng sóc các đặc tính của động cơ điện không đồng bộ hệ số công suất cosp fi p2 đặc tuyến hiệu suất h fi p2 đặc tuyến tốc độ rôto n fi p2 động cơ điện không đồng bộ một pha sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25