over the average concentration of species y
DECONTAMINATION OF CHEMICAL WARFARE SIMULANTS USING ELECTROSPUN MEDIA
... control over the amount of water in the system The presence of a catalyst may reduce the rate of hydrolysis, which allows enough time for the precursors to solvate and thus slowly hydrolyze In the ... substituted by hydroxyl groups The degree of 19 Chapter –II hydrolysis of the precursors depends on the electro negativity of the metal (coupled to the alkoxide) For the reaction to take place, the metal ... between the tip of a nozzle and a collector Once the electrostatic forces overcome the surface tension of the polymer solution at the nozzle tip a jet stream is drawn from the tip of the nozzle The...
- 167
- 573
- 0
Báo cáo y học: " Use of Non-parametric Item Response Theory to develop a shortened version of the Positive and Negative Syndrome Scale (PANSS)" potx
... Poor Rapport (Yes) Yes Yes Yes Yes Very Good N4 Passive Apathetic Social (Yes) Yes Yes Yes Yes Very Good (Yes) No No No Yes Weak (Yes) Yes Yes Yes Yes Very Good (Yes) Yes Yes Yes No Very Good Withdrawal ... Good (Yes) Yes Yes Yes Yes Very good P4 Excitement (Yes) Yes Yes Yes Yes Very Good P5 Grandiosity (Yes) Somewhat Somewhat Yes Yes Good P6 Suspiciousness/ (Yes) Somewhat Yes Yes Yes Very Good (Yes) ... Discrimination of the PANSS Negative Symptoms Items Criterion Rating Negative Symptoms N1 Blunted Affect (Yes) Yes Yes Yes Yes Very Good N2 Emotional Withdrawal (Yes) Yes Yes Yes Yes Very Good N3...
- 63
- 460
- 0
Tài liệu USE OF INTERPRETERS FOR NON-ENGLISH SPEAKING PERSONS pdf
... just as they test the testimony of an English speaking witness In the courtroom, the judge or jury must evaluate the fairness of the questioning and the understanding of the witness, not the interpreter ... disclosed at the request of the interpreter The Supreme Court of Georgia recognizes the actions of the Commission, the Administrative Office of the Courts, the Special Masters, the above-described ... duty to correct any error of interpretation discovered by the interpreter during the proceeding Interpreters should demonstrate their professionalism by objectively analyzing any challenge to their...
- 22
- 615
- 2
Use of an extension of the park's transformation to determine control laws applied to a non sinusoidal permanent magnet synchronous motor
... Using the extension of the Park's transformation, @Ira , @Irp and the variations of the angle p and of versus the rsition have been computed (figure 3) Figure 1: dynamic model of P.M synchronous ... finite supply voltage But, when we look at the d and q components of the current, we see that the variations of the phases currents are linked to the variations of the id currcnt However, the id current ... @Ird = 0.As io = , the expression of the torque of the motor will be nearly the same as the expression for a sinusoidal drive: T, = p.@',(0) i, (10) With these new variables, the electromagnetic...
- 6
- 438
- 2
Báo cáo khoa học: "Unsupervised Recognition of Literal and Non-Literal Use of Idiomatic Expressions" potx
... indexed by the search engine The basic idea is that the more often two terms occur together relative to their overall occurrence the more closely they are related For most pairs of search terms the ... evidence of literal usage of play with fire To determine the strength of the evidence in favour of a literal interpretation, we take the longest chain in which any of the component words of the idiom ... instance, typically have a low coverage and only work for so-called “classical relations” like hypernymy, antonymy etc Distributional approaches usually conflate different word senses and may therefore...
- 9
- 391
- 0
Báo cáo khoa học: "Use of soft X-radiography for early non-destructive detection of floral differentiation in Douglas fir buds" pptx
... examples of the potential use of this technology Reproductive events take place in axillary buds during the course of the vegetative development of the elongating shoot The only way to confirm the ... because of the difficulty of laying the buds correctly onto the film during exposure, which created greater fuzziness, and also because the pictures of the buds and needles were superThe pictures of ... changes in structure The analysis of floral morphology must be associated with an analysis of the morphology of the buds (shape and angle of scale insertion) to distinguish very early vegetative buds...
- 9
- 241
- 0
Báo cáo y học: " Gender-specific profiles of tobacco use among non-institutionalized people with serious mental illness" ppsx
... determined by asking the participants if they had “ever” smoked, whether they had smoked more than 100 cigarettes in their lifetime, when they smoked their last cigarette, and if they smoked every day ... indicated that they had, on occasion, given up buying food so that they would have enough tobacco Many of the current smokers (68.8%) reported that they coped with their psychiatric symptoms by smoking ... of the low-income cut off established by the federal government [38] Smokers in this study spent an average of $160 per month on tobacco; almost 20% of their monthly income In addition, many of...
- 12
- 244
- 0
báo cáo khoa học: " Non-medical use of opioids among HIV-infected opioid dependent individuals on opioid maintenance treatment: the need for a more comprehensive approach" docx
... of the patients (n=46, 19.6%) were being treated with ART Descriptive results during the study period The descriptive analysis of the whole study period is presented in Table During the study ... Plough to study the abuse liability of buprenorphine The other authors who have taken part in this study declared that they not have anything to disclose regarding funding or conflict of interest ... about the direction of effects Although the study started some years ago, this cohort remains a very interesting observational sample of patients, especially for countries that have only recently...
- 23
- 215
- 0
Báo cáo y học: " Use of different but overlapping determinants in a retrovirus receptor accounts for non-reciprocal interference between xenotropic and polytropic murine leukemia viruses" ppt
... PCLSTTVLNLTTDYCVLVELWPKVTYHSPDYVYGQFEKKTKYKREPVSLTLALLLGGLTMGG PCLSTTVLNLTTDYCVLVELWPKVTYHSPDYVYGQFEKKTKYKREPVSLTLALLLGGLTMGG PCLSATVLNRTTDYCVLVELWPRVTYHPPSYVYSQFEKSYRHKREPVSLTLALLLGGLTMGG PCLSATVLNRTTDYCVLVELWPRVTYHPSSYVYSQFEKSYRHKREPVSLTLALLLGGLTMGG ... 390 400 YYEGVAVLGTYSNHTSAPANCSVASQHKLTLSEVTGQGLCVGAVPKTHQALCNTTQKTSDGSYYLAAPAGTIWACNTGLT YYEGVAVLGTYSNHTSAPANCSVTSQHKLTLSEVTGQGLCVGAVPKTHQALCNTTQKTSDGSYYLASPAGTIWACSTGLT YYEGVAVLGTYSNHTSAPANCSAASQHKLTLSEVTGRGLCIGTVPKTHQALCNTTLKTGKGSYYLVAPAGTMWACNTGLT ... either ECL alone did not limit virus entry In the current study, the ability of AKR6 pseudotyped vectors to utilize either the AAUA or the AAAU chimera as a receptor demonstrates that either the...
- 12
- 227
- 0
common errors in the use of the english passive made by the grade 10 non-english majors at tran phu specialised high school, hai phong = những lỗi thường gặp ở thể bị động của học sinh không chuyên khối 10
... Abbreviations Lists of tables and charts PART I - INTRODUCTION I Rationale of the study II Objectives of the study III Scope of the study IV Methods of the study V Organization of the study PART II – ... presented in the later parts of the study From the analysis of the data, the problems will be found and the solutions will be given V Organization of the study: The study consists of three parts: ... many other expressions accept the passive E.g.: The engineers went very carefully into the problem The problem was very carefully gone into by the engineers The engineers went very carefully...
- 62
- 960
- 4
AN INVESTIGATION INTO THE USE OF ROLE PLAY FOR ENHANCING THE SECOND YEAR NON- ENGLISH MAJOR STUDENTS’ SPEAKING PERFORMANCE AT HANOI UNIVERSITYOF BUSINESS AND TECHNOLOGY Nghiên cứu về việc sử dụng đóng vai tình huống để nâng cao khả năng nói tiếng Anh của
... roles What they say is determined by the roles they play, their communicative intentions and the contribution of the other learners” Therefore, it is obviously inferred that the roles of learners ... the option of “very much like the use of role plays in the speaking lessons” 8,3% of them showed the neutral attitudes Only 5% of them chose that they like the role plays used in the speaking ... of them showed that they really like the role play activities Of these students, 65% chose the option of “much like the role play activities in the speaking lessons” 20% of them even chose the...
- 84
- 875
- 0
The relationship between the use of vocabulary learning strategies and learner autonomy of the first year non-major English students at Thainguyen University of Technology
... autonomy Significance of the study The researcher hopes that the findings of the study would help her to know the level of vocabulary learning strategy use and degree of learner autonomy of the ... measured The relationship between TNUT first year students’ use of vocabulary learning strategies and learner autonomy is decided Scope of the study The focus of the study is on the level of TNUT ... for the researcher to carry out this study to explore what the relationship between the use of students’ vocabulary learning strategies and the learner autonomy is Aims of the study The study is...
- 5
- 472
- 1
The use of the Internet tool as an assistance for first-year non-major students at Namdinh University of Technology Education in basic English self-study
... around hypotheses and the final goal of experimental designs is to eliminate alternative hypothesis There are three types of hypotheses: research hypothesis, null hypothesis and alternative hypothesis ... between the posttest scores of the experimental group and the control group Only one the alternative hypothesis was set up for the study: the pretest score of the experimental group and the control ... English proficiency of the experimental group and the control group The alternative hypothesis- the two group had started at the same level of English- was totally eliminated based on the result of...
- 15
- 557
- 0
Common errors in the use of the English passive made by the grade 10 Non-English Majors at Tran Phu Specialised High School, Hai Phong
... presented in the later parts of the study From the analysis of the data, the problems will be found and the solutions will be given V Organization of the study: The study consists of three parts: ... these errors? III Scope of the study: The study is focused on the passive voice However, it is not my ambition to cover every issue of the passive voice Within this small thesis, I desire to give ... discovered yet The analysis of students’ errors is of great importance in teaching English It helps teachers identify students’ strategies of language learning and their level of proficiency so...
- 3
- 416
- 0
Use of DDGS in Swine Diets
... quality, but decreases the saturation of fatty acids, resulting in softer bellies and may negatively affect further processing traits A recent commercial field trial conducted by the University of ... these recommendations are suitable for any particular herd or for any particular animal The USGC disclaims any liability for itself or its members for any problems encountered in the use of these ... supplemental fat The second trial used the same dietary levels of DDGS as in the first trial, but also evaluated the effect of adding or 15% choice white grease to the diet on growth performance There was...
- 15
- 843
- 1
Báo cáo y học: "Use of chinese and western over-the-counter medications in Hong Kong"
... already indicated the needs for western pharmacists to study Chinese medicine [24] A total of 26.2% of the respondents reported consuming Chinese OTC medication in the previous year The majority of ... role in primary care may affect the autonomy and control of the medical professionals [23], particularly the private western medicine practitioners who also dispense medications in their clinics ... integrate pharmacists in the primary care system [20] The role of medical professionals is a dominant factor in defining, controlling and scoping the work of the allied health professionals [21,22]...
- 9
- 516
- 0
Báo cáo y học: "Use of the measure your medical outcome profile (MYMOP2) and W-BQ12 (Well-Being) outcomes measures to evaluate chiropractic treatment: an observational study"
... problem they need assistance with and consider the severity of these symptoms over the last week The third item asks the patient to list an activity (such as walking) that they have had difficulty ... utilised for the study Patients were invited to participate in the study if they were: over the age of 18 years; had no treatment from any health professional for their complaint in the preceding ... step forwards to assess the utility of these questionnaires in another practice setting Therefore the aim of this observational study was to assess the utility of the MYMOP2 and W-BQ12 health...
- 8
- 538
- 0
Tìm thêm: hệ việt nam nhật bản và sức hấp dẫn của tiếng nhật tại việt nam xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam điều tra với đối tượng sinh viên học tiếng nhật không chuyên ngữ1 khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu nội dung cụ thể cho từng kĩ năng ở từng cấp độ xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct mở máy động cơ lồng sóc mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ đặc tuyến mômen quay m fi p2 động cơ điện không đồng bộ một pha thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008 chỉ tiêu chất lượng 9 tr 25