hybrid rice became an important approach in improving the economic efficiency of china s agriculture lin and pingali 1994 report that hybrid rice had about 15 percent yield advantage over conventional inbreds accordi

RESPONSIBLE REFORM OF THE WORLD BANK - THE ROLE OF THE UNITED STATES IN IMPROVING THE DEVELOPMENT EFFECTIVENESS OF WORLD BANK OPERATIONS pptx

Ngày tải lên : 29/03/2014, 08:20

... disparities in access to and control of productive assets (such as land, information, technology and credit), human assets (such as education and training) and social assets (such as business networks), ... numbers of pests and beneficial insects in their fields Based on their analysis of the agricultural ecosystem, farmers make decisions about how to manage their crops and pests for maximum yield and ... to the country s priorities as set out in the PRSP by stating how loan and grant agreements support the goals and strategies set out in the PRSP Policy-based loans and grants must conform to the...

42
611
0

Tài liệu Báo cáo khoa học: The effect of small molecules in modulating the chaperone activity of aB-crystallin against ordered and disordered protein aggregation pdf

Ngày tải lên : 18/02/2014, 16:20

... solvent accessibility of the N-terminal tryptophan residues (Trp9 and Trp60), as assessed by intrinsic ﬂuorescence (data not shown), in the presence of these compounds Thus, it appears that the ... diseases such as Parkinson s, and the A53T mutant is associated with earlyonset Parkinson s disease Thus, our results suggest that small molecules that act on sHsps in a similar manner to Arg-HCl ... to speciﬁcally increase the activity of aB-crystallin against DTT-induced precipitation of insulin at intermediate and high concentrations, and it also increased the activity of aB-crystallin in...

13
613
0

Báo cáo hóa học: " Improving the emission efficiency of MBE-grown GaN/AlN QDs by strain control" doc

Ngày tải lên : 20/06/2014, 23:20

... properties, the GaN QDs in sample A have the largest strain, while the QDs in sample D have the smallest strain As observed from the RHEED patterns for S- K growth of GaN QDs, it takes 18, 25, 30, and ... relaxed; hence, the strain status of the following AlN spacer and GaN QDs can be controlled by varying the thickness of the AlN spacer The samples were grown on c-plane sapphire substrates by PA-MBE ... insertion layer, and aGaN-bulk and aAlN-bulk are the standard in- plain lattice constants of GaN and AlN bulks [12] According to the XRD reciprocal mapping data, the relaxation factor of the GaN...

6
247
0

the impacts of fluctuations of inputs price on the economic efficiency of tea production of farmer housedolds in thai nguyen province

Ngày tải lên : 20/08/2014, 22:08

... province in case of increasing prices of inputs From the results of studies assessing the impact that increasing price of inputs has on the economic efficiency in tea production of farmers in ... households Using creased regression analysis to analyze the impact of increase in the cost of inputs on economic efficiency of households 9 Chapter EFFECTS OF INCREASING PRICE OF INPUTS ON ECONOMIC ... influence of price fluctuations of inputs on efficiency of tea production of households in the province Object and scope of the thesis research * Object: The main researching objects of the thesis research...

26
410
0

Solutions to improve the economic efficiency of agricultural land use in yen bai province during 2012 2020

Ngày tải lên : 29/08/2015, 10:01

... appropriateness of the type of land use that as a basis to propose solutions appropriate land use, effective in mountainous areas is the problem and strategic and urgent local and national targets to ensure ... agricultural land use and the preferred solution to improve the economic efficiency of agricultural land use mainly 3.5 The system of research targets and criterias: research indicator system consists of ... household interviews surveys, focus group discussions, consultations of experts The primary information to be investigated in years (2008-2011) 3.3 Methods of information synthesizing and analysis:...

27
359
1

Hydrophytes may play an important role in sewage disinfection in constructed wetlands

Ngày tải lên : 05/09/2013, 09:38

... prospect in the CWs sewage purification system Hydrophyte is an indispensable component in CWs Researches show that the plants can produce allelochemicals and affect on the growth of other living ... extracts controlling virus was rarely seen in sewage disinfection in CWs Two viruses with bacterial hosts (coliphages), T4 and f2, were used in this research as surrogates for human enteroviruses ... (2007) studied the anti-tobacco mosaic virus (TMV) about Ailanthus altissma and Brucea javanica, and indicated that their extracts not only inhibited the infection of TMV, but also had the inhibition...

7
417
0

Tài liệu Báo cáo Y học: The b-1,4-endogalactanase A gene from Aspergillus niger is speciﬁcally induced on arabinose and galacturonic acid and plays an important role in the degradation of pectic hairy regions pdf

Ngày tải lên : 21/02/2014, 01:21

... demonstrated that a substantial amount of the L-arabinose residues (14%) in soy arabinogalactan is present as terminal residues [21], suggesting that of these arabinogalactans, soy arabinogalactan is the ... panels C and D) This indicates that the substrate binding site in GALA that binds the reducing-end sugar is very important in enzyme substrate interaction Previous studies using an Aspergillus b-1,4-endogalactanases ... degradation of both linear and L-arabinose-substituted galactan side chains of pectin This is in agreement with a previous study in which the synergy of enzymes degrading the pectin side chains was studied...

9
669
0

Tài liệu Báo cáo khoa học: The molecular surface of proteolytic enzymes has an important role in stability of the enzymatic activity in extraordinary environments pptx

Ngày tải lên : 21/02/2014, 03:20

... KAVSSGIVVAAAAGNEGSSGSSSTVGYPAKYPSTIAVGAVNSSNQRASFSSAGSELDVMAPGVSIQSTLP KAVSSGIVVAAAAGNEGSSGSSSTVGYPAKYPSTIAVGAVNSSVQRASFSSAGSELDVMAPGVSIQSTLP KAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVGPELDVMAPGVSIQSTLP ... KAYASGIVVVAAAGNSGSSGSQNTIGYPAKYDSVIAVGAVDSNKNRASFSSVGAELEVMAPGVSVYSTYP KAVSSGIVVAAAAGNEGSSGSTSTVGYPAKYPSTIAVGAVNSSNQRASFSSVGSELDVMAPGVSIQSTLP KAVSSGIVVAAAAGNEGSSGSTSTVGYPAKYPSTIAVGAVNSSNQRASFSSAGSELDVMAPGVSIQSTLP KAVSSGIVVAAAAGNEGSSGSSSTVGYPAKYPSTIAVGAVNSSNQRASFSSAGSELDVMAPGVSIQSTLP ... TIAALNNSIGVLGVSPSASLYAVKVLDSTGSGQYSWIINGIEWAISNNMDVINMSLGGPTGSTALKTVVD TIAALNNSIGVLGVSPSASLYAVKVLDSTGSGQYSWIINGIEWAISNNMDVINMSLGGPSGSTALKTVVD TIAALNNSIGVLGVSPSASLYAVKVLDSTGSGQYSWIINGIEWAISNNMDVINMSLGGPSGSTALKTVVD...

9
489
0

Báo cáo khoa học: NtKTI1, a Kunitz trypsin inhibitor with antifungal activity from Nicotiana tabacum, plays an important role in tobacco’s defense response pot

Ngày tải lên : 23/03/2014, 03:20

... diameter of the lesions was about 44 mm in the leaves of antisense plants, but only 17 mm in the leaves of the sense line (Fig 5A) Overall, the resistance levels were consistent with the expression ... 30 days (Fig 5B) By contrast, seedlings from sense lines were substantially less susceptible, and disease progressed much more slowly than in the other two lines After 30 days, only 43% had died ... serine, cysteine, aspartic and metalloproteinase inhibitors [11] Serine proteinases appears to be the largest family of proteinases, and plant serine PIs have been classiﬁed into several subfamilies,...

13
501
0

Báo cáo khoa học: Piecing together the structure of retroviral integrase, an important target in AIDS therapy pptx

Ngày tải lên : 29/03/2014, 23:20

... experiments that found IN DNA interaction sites by photocrosslinking also suggested that IN acts as an octamer [85] Comparison of simulation analysis against time-resolved ﬂuorescence anisotropy measurements ... between the domains and the linkers As shown in Fig 2, the N-terminal domain (NTD) of HIV-1 IN contains residues 1–46, followed by a linker consisting of residues 47–55 The catalytic core domain (CCD) ... capable of crosslinking to DNA It is quite possible that these interactions form the basis of its inhibitory capacity The inhibitors discussed above, as well as raltegravir (Fig 5A), the only IN inhibitor...

21
354
0

Báo cáo sinh học: " Vaccinia virus A12L protein and its AG/A proteolysis play an important role in viral morphogenic transition potx

Ngày tải lên : 18/06/2014, 18:20

... early stage of the membrane biogenesis Thus, the researches on most of the VV structural precursor proteins that undergo proteolytic maturation elucidated that VV recruits and organizes the first ... aggregates of accumulated electron-dense materials and numerous vesicles/tubules engulfing viroplasms, demonstrating that A17L is an essential component for generation of IV and IMV membranes [13,14,5] ... in the absence of A12L expression In order to study the phenotypic effects of A12L repression in virus assembly, T-REx 293 cells were infected with vvtetOA12L in the presence and absence of Tet...

6
397
0

báo cáo hóa học: " Maize pollen is an important allergen in occupationally exposed workers" doc

Ngày tải lên : 20/06/2014, 00:20

... immunoblot analysis and discussed its findings The manuscript has been read and approved by all authors All of them participated substantially in analysis and discussion of data Acknowledgements The ... and dry, it dehisces and releases pollen Maize pollen is anemophilous (dispersed by wind) and most pollen grains fall within a few meters of the tassel because of its high settling velocity In ... several layers of leaves, with silks at their end as elongated stigmas The apex of the stem ends in the tassel, an inflorescence of male flowers When the tassel is mature and conditions are suitably...

29
387
0

Báo cáo hóa học: " Vaccinia virus A12L protein and its AG/A proteolysis play an important role in viral morphogenic transition" pdf

Ngày tải lên : 20/06/2014, 01:20

... early stage of the membrane biogenesis Thus, the researches on most of the VV structural precursor proteins that undergo proteolytic maturation elucidated that VV recruits and organizes the first ... aggregates of accumulated electron-dense materials and numerous vesicles/tubules engulfing viroplasms, demonstrating that A17L is an essential component for generation of IV and IMV membranes [13,14,5] ... in the absence of A12L expression In order to study the phenotypic effects of A12L repression in virus assembly, T-REx 293 cells were infected with vvtetOA12L in the presence and absence of Tet...

6
401
0

Báo cáo hóa học: " Research Article A Two-Stage Approach for Improving the Convergence of Least-Mean-Square Adaptive Decision-Feedback Equalizers in the Presence of Severe " doc

Ngày tải lên : 22/06/2014, 19:20

... training symbols These symbols not transmit any new information, reducing the overall throughput of the system Conventional analyses of adaptive algorithms use the mean-squared error (MSE) as the ... applications Hassibi discusses [12] some of the fundamental diﬀerences in the performance of gradient-based estimators such as the LMS algorithm and time-averaged recursive estimators such as the RLS ... algorithm in the cases of modeling errors and incomplete statistical information concerning the input signal, interference, and noise parameters Hassibi [12] examines the conditions for which LMS can...

13
365
0

Effective Presentations- Dilek Tokay Presentations play an important role in both docx

Ngày tải lên : 28/06/2014, 12:20

... audience and encourages answers 13 uses an ice-breaker appealing to audience 's sense of humour 14 evaluates response from the audience, answers questions, restates or paraphrases if some points are ... business purposes makes his/ her sentences comprehensible with no strain on the audience has correct stress and intonation pattern to emphasize important points or questions produces no utterances, ... introduction that attracts the audience 's attention has a strong body with support & links to the thesis statement gives support examples with smooth transitions limits the topic and establishes...

6
269
0

Báo cáo y học: "Defective CD4+CD25+ regulatory T cell functioning in collagen-induced arthritis: an important factor in pathogenesis, counter-regulated by endogenous IFN-γ" potx

Ngày tải lên : 09/08/2014, 06:22

... redness and/ or swelling in more than one joint; score 3, redness and/ or swelling in the entire paw; score 4, deformity and/ or ankylosis Media, reagents and antibodies Morgan and colleagues [26] have ... arthritis five times a week The disease severity was recorded with the following scoring system for each limb: score 0, normal; score 1, redness and/ or swelling in one joint; score 2, redness and/ or ... immunisation, we can conclude that Treg cells are important in the pathogenesis of CIA, not only in the immunisation phase but also in the effector phase In contrast to the findings of Morgan and...

14
403
0

báo cáo khoa học: " Transcriptional profiling of Medicago truncatula under salt stress identified a novel CBF transcription factor MtCBF4 that plays an important role in abiotic stress responses" ppt

Ngày tải lên : 11/08/2014, 11:21

... water-channel protein and membrane transporter protein; the second type was involved in signal transduction and expression regulatory processes, such as transcription factors and kinases [4] Transcription ... positions and consensus sequences are shown at the top of each panel The conserved AP2 DNA-binding domain is indicated as the underlined segment Stars and triangles indicate the CBF signature sequences; ... phenylpropanoid metabolites found mainly in legumes Over- expression of isoflavone 7-O-methyltransferase reportedly increases disease resistance in M sativa and is regarded as the entry point of the isoflavone...

19
590
0

Báo cáo y học: "Citrullinated vimentin as an important antigen in immune complexes from synovial fluid of rheumatoid arthritis patients with antibodies against citrullinated proteins" pot

Ngày tải lên : 12/08/2014, 14:22

... 1,600 SF24 results RA > 1,600 SF25 results RA 640 1,775 SF26 results RA 227 ND SF27 results SpA 0 SF28 results SpA ND 1,6 SF29 results SpA SF30 results SpA SF31 results SpA SF32 results SpA SF33 ... transfer of proteins was checked by means of Ponceau S staining Detection of citrullinated proteins The presence of citrullinated proteins on the nitrocellulose blots was detected using the anti-modified ... is mainly IgM [12], is used in diagnostic tests for RA and has a sensitivity of 78.6% and a specificity of 80.8% [13] The RF factor is also found in other diseases such as systemic sclerosis...

10
309
0

Báo cáo y học: "Pro/con debate: Octreotide has an important role in the treatment of gastrointestinal bleeding of unknown origin" pptx

Ngày tải lên : 12/08/2014, 23:24

... acid suppression probably stabilizes clot [11] and, possibly, accelerates healing of bleeding lesions over the 72 hours following endoscopic hemostasis [16,17] Somatostatin and octreotide inhibit ... AB is a consultant for AstraZeneca and Atlana Pharma References Reubi JC, Schaer JC, Laissue JA, Waser B: Somatostatin receptors and their subtypes in human tumors and in peritumoral vessels Metabolism ... purposes) suppressing effect of pantoprazole was less than previously reported [25], and differences disappeared after the initial to 12 hours of the 24 hour intravenous infusions [26] An older,...

4
395
0

Developing an integrated quantity and quality approach for improving the performance of multistage manufacturing systems

Ngày tải lên : 09/09/2015, 17:58

... system modeling and performance prediction This thesis incorporates the study of these uncertainties into the analysis of multistage manufacturing systems, and proposes an integrated quantity and quality ... , and the inspection machine is inspecting a part 2: SF is f L , and the inspection machine is inspecting a part 3: SF is f H , and the inspection machine is idle 4: SF is f L , and the inspection ... processing time models are most suitable for studying these systems as in Chapters 3, and In this section, the author ﬁrst studies a single stage manufacturing system with sampled inspection as shown...

185
309
0