cơ hội và thách thức đối với hoạt động đầu tư của nhật bản vào việt nam

Báo cáo khoa học: " Uncoupling GP1 and GP2 expression in the Lassa virus glycoprotein complex: implications for GP1 ectodomain shedding" ppt

Báo cáo khoa học: " Uncoupling GP1 and GP2 expression in the Lassa virus glycoprotein complex: implications for GP1 ectodomain shedding" ppt

Ngày tải lên : 12/08/2014, 04:21
... full length proteins from Escherichia coli (E coli), both lack post-translational modifications, namely glycosylation The bacterially expressed proteins were readily recognized by mAbs raised against...
  • 17
  • 332
  • 0
Lecture 3 DNA RNA and protein synthesis great

Lecture 3 DNA RNA and protein synthesis great

Ngày tải lên : 13/03/2014, 16:36
...  A polymer {a compound made of repeating subunits}   WHAT DOES “DNA” STAND FOR? DNA’s proper name isDeoxyribonucleic acid!  Consists of a ribose SUGAR with a “missing oxygen” (that’s the de-oxy...
  • 17
  • 671
  • 2
Tài liệu Báo cáo khoa học: Template requirements and binding of hepatitis C virus NS5B polymerase during in vitro RNA synthesis from the 3¢-end of virus minus-strand RNA docx

Tài liệu Báo cáo khoa học: Template requirements and binding of hepatitis C virus NS5B polymerase during in vitro RNA synthesis from the 3¢-end of virus minus-strand RNA docx

Ngày tải lên : 20/02/2014, 01:20
... Nucleotides are numbered increasingly from the 3¢-end of the RNA; the five first stem-loops (A) are named as reported by Schuster et al [13] The 228 nt of domain I fold into five stable stem-loops ... are shown (A) Domain I is composed by 228 nt located at the 3¢ end The first five stem loops are named as described in [13] (B) Secondary structure of a fragment spanning from nt 229–365 in domain...
  • 15
  • 597
  • 0
Báo cáo khoa học: Molecular cloning and characterization of the crustacean hyperglycemic hormone cDNA from Litopenaeus schmitti Functional analysis by double-stranded RNA interference technique pot

Báo cáo khoa học: Molecular cloning and characterization of the crustacean hyperglycemic hormone cDNA from Litopenaeus schmitti Functional analysis by double-stranded RNA interference technique pot

Ngày tải lên : 23/03/2014, 10:20
... eyestalk CHHs of penaeid shrimps such as Penaeus monodon (80%), M ensis (77%) and Litopenaeus vannamei (73%) (Fig 1A) The deduced amino acid sequence of the obtained cDNA corresponded to the one ... cDNA reported for Marsupenaeus japonicus (AB035724), Metapenaeus ensis (AF109775), Litopeneaus vannamei (AY434016), Peneaus monodon (AF104930) and CHH nucleotide sequence obtained from Litopeneaus ... of hyperglycemic and molt-inhibiting activity from sinus glands of the penaeid shrimp Penaeus vannamei Gen Comp Endocrinol 103, 41–53 Spanings-Pierrot C, Soyez D, Van Herp F, Gompel M, Skaret G,...
  • 9
  • 486
  • 0
cdna preparation and characterization

cdna preparation and characterization

Ngày tải lên : 10/04/2014, 11:12
... C o n t r i b u t o r s to V o l u m e 3 Article numbers are in parentheses following the names of contributors Affiliations listed are current CHRISTOPHER ASTON (4), Department of Chemistry, ... Chemistry, W M Keck Laboratory for Biomolecular Imaging, New York University, New York, New York 10003 NAMADEV BASKARAN(3, 16), Genome Therapeutics Corporation, Waltham, Massachusetts 02453 ALASTAIR ... that begin by an initial cDNA synthesis step and can be used to amplify m R N A from single cells, namely, reverse transcriptasepolymerase chain reaction (RT-PCR) 6-8 and antisense R N A (aRNA) amplificationY...
  • 588
  • 178
  • 0
Báo cáo sinh học: " Nucleocapsid formation and RNA synthesis of Marburg virus is dependent on two coiled coil motifs in the nucleoprotein" pot

Báo cáo sinh học: " Nucleocapsid formation and RNA synthesis of Marburg virus is dependent on two coiled coil motifs in the nucleoprotein" pot

Ngày tải lên : 18/06/2014, 18:20
... was cloned in frame with a mutant of Ebola virus VP30 (MFlag; Fig 2A, [14]) The fusion protein, named C1C2MFlag, was coexpressed with the N-terminus of NP (NP∆441–695), which contains the two ... 315GVNVGEQYQQLREAAHDAEVKLQRRHEHQEIQAIAEDDEERKILEQFHLQKTEITHSQTLAVLSQKREKLARLAAEIENNIVEDQG400 EBOV NP V Y QL A A QL L I 333GVNVGEQYQQLREAATEAEKQLQQYAESRELDHLGLDDQEKKILMNFHQKKNEISFQQTNAMVTLRKERLAKLTEAITAASLPKTS418 Figure to 367 coil motif in Zaire Ebola virus NP (A) In silico analysis...
  • 8
  • 393
  • 0
Báo cáo sinh học: " Stimulation of poliovirus RNA synthesis and virus maturation in a HeLa cell-free in vitro translation-RNA replication system by viral protein 3CDpro" docx

Báo cáo sinh học: " Stimulation of poliovirus RNA synthesis and virus maturation in a HeLa cell-free in vitro translation-RNA replication system by viral protein 3CDpro" docx

Ngày tải lên : 19/06/2014, 08:20
... visualized by autoradiography The reaction products were quantitated with a Phosphorimager (Molecular Dynamics Storm 800) by measuring the amount the amount of [α-32P]CMP incorporated into RNA Alternatively,...
  • 19
  • 489
  • 0
Báo cáo hóa học: " Nucleocapsid formation and RNA synthesis of Marburg virus is dependent on two coiled coil motifs in the nucleoprotein" pdf

Báo cáo hóa học: " Nucleocapsid formation and RNA synthesis of Marburg virus is dependent on two coiled coil motifs in the nucleoprotein" pdf

Ngày tải lên : 20/06/2014, 01:20
... was cloned in frame with a mutant of Ebola virus VP30 (MFlag; Fig 2A, [14]) The fusion protein, named C1C2MFlag, was coexpressed with the N-terminus of NP (NP∆441–695), which contains the two ... 315GVNVGEQYQQLREAAHDAEVKLQRRHEHQEIQAIAEDDEERKILEQFHLQKTEITHSQTLAVLSQKREKLARLAAEIENNIVEDQG400 EBOV NP V Y QL A A QL L I 333GVNVGEQYQQLREAATEAEKQLQQYAESRELDHLGLDDQEKKILMNFHQKKNEISFQQTNAMVTLRKERLAKLTEAITAASLPKTS418 Figure to 367 coil motif in Zaire Ebola virus NP (A) In silico analysis...
  • 8
  • 379
  • 0
Báo cáo hóa học: "Preparation and characterization of carbon nanofluid by a plasma arc nanoparticles synthesis system" pot

Báo cáo hóa học: "Preparation and characterization of carbon nanofluid by a plasma arc nanoparticles synthesis system" pot

Ngày tải lên : 21/06/2014, 04:20
... horizontal mesh heat pipe Energy Conv Manag 2011, 52:292 Kulkarni DP, Namburu PK, Bargar HE, Das DK: Convective heat transfer and fluid dynamic characteristics of SiO2-ethylene glycol/water nanofluid ... http://www.nanoscalereslett.com/content/6/1/293 Page of 11 Table List of fabrication parameters and properties for carbon/water nanofluid Name NC-70 NC-80 Working currents (A) 70 80 Working voltage (V) 24.3~24.7 26.2~26.8 Working power...
  • 11
  • 554
  • 0
Báo cáo sinh học: "Therapeutic dendritic cell vaccine preparation using tumor RNA transfection: A promising approach for the treatment of prostate cancer" pps

Báo cáo sinh học: "Therapeutic dendritic cell vaccine preparation using tumor RNA transfection: A promising approach for the treatment of prostate cancer" pps

Ngày tải lên : 14/08/2014, 19:22
... with dendritic cells for prostate cancer Int J Cancer 2007, 121(3):467-73 Boczkowski D, Nair SK, Nam JH, Lyerly HK, Gilboa E: Dendritic cells pulsed with RNA are potent antigen-presenting cells...
  • 7
  • 363
  • 0
Cambridge.University.Press.The.Crisis.of.Literature.in.the.1790s.Print.Culture.and.the.Public.Sphere.Nov.1999.pdf

Cambridge.University.Press.The.Crisis.of.Literature.in.the.1790s.Print.Culture.and.the.Public.Sphere.Nov.1999.pdf

Ngày tải lên : 21/09/2012, 11:00
... suppose the two first persons you would choose to see’, writes Hazlitt, ‘would be the two greatest names in English literature, Sir Isaac Newton and Mr Locke.’ Williams’s point is that if ‘the use ... But it also forces us to recognize the extent to which the social formation within which these dynamics operated was characterized by overlapping points of consensus and difference It was wholly ... extent to which ideas about universality were differentially produced, but the ways that these dynamics were mediated rather than eliminated by contested notions of the social identity of reason...
  • 316
  • 972
  • 2
Cambridge.University.Press.War.Land.on.the.Eastern.Front.Culture.National.Identity.and.German.Occupation.in.World.War.I.May.2000.pdf

Cambridge.University.Press.War.Land.on.the.Eastern.Front.Culture.National.Identity.and.German.Occupation.in.World.War.I.May.2000.pdf

Ngày tải lên : 21/09/2012, 11:02
... German administration, this study uses German names given to the locations under occupation to reXect and trace those ambitions, providing current names as needed (while obviously in no way endorsing ... the German side, naming the battle was a task of great symbolic signiWcance Afterwards, LudendorV explained that rather than choosing one of the small locales with unmelodious names, ‘‘at my suggestion, ... Everywhere were people whose surnames were messes of ethnicity (or living testimony to the accretion of history and identity, depending on one’s view) Even so, surnames were not reliable indicators...
  • 320
  • 957
  • 3
Preparation And Practice

Preparation And Practice

Ngày tải lên : 08/10/2012, 09:06
  • 102
  • 578
  • 1

Xem thêm