a biogas plant seldom
Tài liệu Báo cáo khoa học: Structural insights into the substrate specificity and activity of ervatamins, the papain-like cysteine proteases from a tropical plant, Ervatamia coronaria ppt
Ngày tải lên :
18/02/2014, 16:20
... coronaria
Raka Ghosh, Sibani Chakraborty, Chandana Chakrabarti, Jiban Kanti Dattagupta and
Sampa Biswas
Crystallography and Molecular Biology Division, Saha Institute of Nuclear Physics, Kolkata, ... acid
at a particular position for this family of plant cysteine pro-
teases. The primers used were 5¢-TTGCCTGAGCA TGTT
GATTGGAGAGCGA AAG-3 ¢ (forward) and 5¢-GGGAT
AATAAGGTAATCTAGTGATTCCAC-3¢ ... S, Sundd M, Jagan-
nadham MV & Dattagupta JK (1999) Crystallization
and preliminary X-ray analysis of ervatamin B and C,
two thiol proteases from Ervatamia coronaria. Acta
Crystallogr D 55,...
- 14
- 634
- 0
Tài liệu Báo cáo khoa học: Spectroscopic characterization of a higher plant heme oxygenase isoform-1 from Glycine max (soybean) ) coordination structure of the heme complex and catabolism of heme docx
Ngày tải lên :
19/02/2014, 05:20
... vanished
after 30 min, and instead, an absorption peak
appeared at 637 nm, suggesting the formation of
CO–verdoheme. The 637 nm band disappeared gradu-
ally and was replaced by a new broad band ... T, Zhang X, Sun D,
Sato M, Sasahara M, Kayama T, Ikeda-Saito M &
Yoshida T (2000) Histidine 20, the crucial proximal
axial heme ligand of bacterial heme oxygenase Hmu O
from Corynebacterium ... specific absorption bands. Heme catabolism by
HOs of mammals, pathogenic bacteria, cyanobacteria
and probably insects is considered to have a similar
mechanism, because the characteristic absorption
bands...
- 16
- 617
- 0
Báo cáo y học: "A Comparative Effectiveness Study of Bone Density Changes in Women Over 40 Following Three Bone Health Plans Containing Variations of the Same Novel Plant-sourced Calcium"
Ngày tải lên :
25/10/2012, 11:10
... investigators‟ DXA (Total Body Du-
al-energy X-ray Absorptiometry) database, from par-
ticipants at a local health fair, and from referrals from
subjects who agreed to participate. All subjects ... known as
„AlgaeCal‟ or „AC‟) made by milling whole,
live-harvested sea algae found on the South American
coastline. In addition to calcium, the algae contained
other naturally occurring minerals ...
61. Marone PA, Yasmin T, Gupta RC, et al: Safety and toxicological
evaluation of AlgaeCal (AC), a novel plant- based calcium sup-
plement. Toxicol Mech Methods. 2010; 20:334-344.
62. Kaats GR:...
- 12
- 663
- 0
Boosting biogas yield of anaerobic digesters by utilizing concentrated molasses from 2nd generation bioethanol plant
Ngày tải lên :
05/09/2013, 16:10
... meet the seasonal variation in energy demand. Biogas plant connected with CHP
(combined heat and power plant) is typically designed for base load due inadequacy of the material
characterized ... dietary fibres and klason lignin was
analysed as described by Knudsen [13] whereas mineral analysis (primarily cations and anions) was
conducted as according to Fang et al [14]. Fat was determined ... glucose and arabinose (Table
1). Although not abundant, small amount of other sugars such as rhamnose (<1g/kgTS), mannose and
galactose were also observed. Furthermore, analysis quantified approximately...
- 12
- 763
- 1
Tài liệu Báo cáo khoa học: C-Terminal extension of a plant cysteine protease modulates proteolytic activity through a partial inhibitory mechanism doc
Ngày tải lên :
14/02/2014, 14:20
... aa
208 aa
24 aa
BamH
34 aa
Start
Stop
Xho1
N
-Pro Protease domain
Protease domain
CT - ex
380 aa
1
II
NP
114 aa
208 aa
BamH1
34 aa
Start
Stop
Xho1
SS SS
G
SSS
S
N-Pro
356 aa
III
MSTLFII
S
ILLFLAS
F
SYAMDI
S
TIEYKYDKSS
AWRTDEEVKEIYELWLAKHDKVY
SG
LVEYEKRFEIFKDNLKFIDEH
NSENHTYKMGLTPYTDLTNEEFQAIYLGTRSDTIHRLKRTINISERYAYEAGDNLPEQIDWRKKGAVTPVKNQGKCG
SCWAFSTVSTVESINQIRTGNLISLSEQQLVDCNKKNHG
CKGGAFVYAYQYIIDNGGIDTEANYPYKAVQGPCRAAK
KVVRIDGYKGVPHCNENALKKAVASQPSVVAIDASSKQF
QHYKSGIFSGPCGTKLNHGVVIVGYWKDYWIVRNSW
GRYWGEQGYIRMKRVGGCGLCGIARLPYYPTKA
AGDENSKLETPELLQWSEEAFPLA
IV
A
B
66 ... of a plant cysteine protease
modulates proteolytic activity through a partial inhibitory
mechanism
Sruti Dutta, Debi Choudhury, Jiban K. Dattagupta and Sampa Biswas
Crystallography and Molecular ... protease from the latex of Ervatamia coronaria.
Biosci Biotechnol Biochem 62, 1947–1955.
15 GuhaThakurta P, Biswas S, Chakrabarti C, Sundd M,
Jagannadham MV & Dattagupta JK (2004) Structural
basis...
- 13
- 759
- 0
Tài liệu Báo cáo khoa học: Crystal structure of Klebsiella sp. ASR1 phytase suggests substrate binding to a preformed active site that meets the requirements of a plant rhizosphere enzyme doc
Ngày tải lên :
16/02/2014, 09:20
... QuikChange site-directed
mutagenesis kit (Stratagene, La Jolla, CA, USA). Plasmid
pET-1TK was used as template and Kleb(HtoA)fw
(5¢-GCTTAGCCGCGCCGGCATTCG) and Kleb(HtoA)rv
(5¢-CGAATGCCGGCGCGGCTAAGC) ... glucose-
1-phosphatase and human prostatic-acid phosphatase. The polypeptide
chain is organized into an a and an a ⁄ b domain, and the active site is
located in a positively charged cleft between the domains. ... phytate with pH optima in the
acidic range. They consist of two domains, a large a ⁄ b
domain and a small a domain with the catalytic site at
the interface of the two domains [4,5]. HAPs can initi-
ate...
- 13
- 766
- 0
Tài liệu BIOCHEMICAL TARGETS OF PLANT BIOACTIVE COMPOUNDS A pharmacological reference guide to sites of action and biological effects doc
Ngày tải lên :
17/02/2014, 05:20
... in plants used for stimulatory drinks such as Ilex
paraguayensk (matC) (Aquifoliaceae), Coffea species (coffee) (Rubiaceae), Paullinia cupana
(guarana) (Sapindaceae), Cola acuminata (cola) and ... alkaloids are
or-glycosidase inhibitors, namely
(sources in parentheses) alexine
(Alexa leiopetala
(Fabaceae)), australine
(Castanospermum australe
(Fabaceae)) and casuarine
(Casuarina ...
Artemisia annua
(Asteraceae) is of major importance as an antimalarial because of extensive resistance of
Plasmnodium falciparum
to antimalarials such as chloroquine. Artemisinin in has a...
- 861
- 443
- 0
Tài liệu Báo cáo khoa học: Insights into the structure of plant a-type phospholipase D Susanne Stumpe, Stephan Konig and Renate Ulbrich-Hofmann ¨ ppt
Ngày tải lên :
19/02/2014, 02:20
... fact that EDTA
effects a marked stabilization (Table 1), however, indi-
cates an additional destabilizing effect by calcium ions.
Destabilization of PLDa2 by calcium ions was also
indicated by ... protein absorbance at 280 nm. Aldolase (150 kDa),
ovalbumin (45 kDa), chymotrypsinogen A (25 kDa), and
cytochrome c (12.3 kDa) (Serva, Heidelberg, Germany)
were used as molecular mass standards.
Absorption ... (w ⁄ v) acrylamide] were stained
with Coomassie Brilliant Blue G250 and quantified by
densitometric evaluation at 595 nm (CD60; Desaga, Darm-
stadt, Germany).
Small angle X-ray solution scattering...
- 11
- 750
- 0
Tài liệu Báo cáo khoa học: 1,5-Diamino-2-pentyne is both a substrate and inactivator of plant copper amine oxidases ppt
Ngày tải lên :
19/02/2014, 16:20
... experiments
performed according to that with DABY-inactivated GPAO
[8] revealed that the pI value of the DAPY-inactivated
GPAO was not dramatically changed. The native GPAO
is characterized by a pI of 7.2 [18]. After ... 1,5-diamino-2-pentyne
(DAPY). The unsymmetrical DAPY comprises both a
propargyl and homopropargyl amine.
DAPY was synthesized and tested as a substrate of two
plant CAOs. DAPY acts as a mechanism-based inhibitor ... mixture prepared in 0.1
M
ammonium bicarbonate containing ACA as a reagent for
trapping of the product aminoaldehyde, where several new
peaks appeared. ACA itself is represented by a peak with
m/z...
- 13
- 604
- 0
Tài liệu Báo cáo khoa học: Plant a-amylase inhibitors and their interaction with insect a-amylases ppt
Ngày tải lên :
21/02/2014, 03:20
... inhibitor;
HSA, human salivary a- amylase; LCAI, Lachrima jobi chitinase/
a- amylase inhibitor; PAI, pigeonpea a- amylase inhibitor; PPA, por-
cine pancreatic a- amylase; RASI, rice a- amylase/subtilisin ... bean; AMY1
and AMY2, a- amylases from barley seeds; BASI, barley a- amylase
subtilisin inhibitor; BLA, Bacillus licheniformis a- amylase; CAI,
cowpea a- amylase inhibitor; CHFI, corn Hageman factor ... Brazil, Fax: + 5 5 6 1 340 3624,
Tel.: + 55 61 448 4705, E-m ail: ocfranco@cenargen.embrapa.br
Abbreviations: AAI, Amaranthus a- amylase inhibitor; a- AI1 and
a- AI2, a- amylase inhibitors 1 and 2 from...
- 16
- 539
- 0
Báo cáo khoa học: Crystal structure and enzymatic properties of a bacterial family 19 chitinase reveal differences from plant enzymes pdf
Ngày tải lên :
07/03/2014, 11:20
... L, Hamid Q & Elias JA (2004) Acidic
mammalian chitinase in asthmatic Th2 inflammation
and IL-13 pathway activation. Science 304, 1678–
1682.
4 Kasprzewska A (2003) Plant chitinases ) regulation ... 491–503.
24 Aronson NN, Halloran BA, Alexyev MF, Amable L,
Madura JD, Pasupulati L, Worth C & Van Roey P
(2003) Family 18 chitinase–oligosaccharide substrate
interaction: subsite preference and anomer ... demonstrated by kinetic
and molecular modeling studies. Plant Mol Biol 52, 43–
52.
26 Ueda M, Kojima M, Yoshikawa T, Mitsuda N, Araki
K, Kawaguchi T, Miyatake K, Arai M & Fukamizo T
(2003) A novel...
- 12
- 399
- 0
Báo cáo khoa học: Epl1, the major secreted protein of Hypocrea atroviridis on glucose, is a member of a strongly conserved protein family comprising plant defense response elicitors potx
Ngày tải lên :
07/03/2014, 12:20
... Comparini C, Calamassi R, Pazzagli L,
Cappugi G & Scala A (2004) Cerato-platanin protein is
located in the cell walls of ascospores, conidia and
hyphae of Ceratocystis fimbriata f. sp. Platani. ... 341–346.
25 Pazzagli L, Cappugi G, Manao G, Camici G, Santini A
& Scala A (1999) Purification, characterization, and
amino acid sequence of cerato-platanin, a new phyto-
toxic protein from Ceratocystis ... Stability of
clades was evaluated by 1000 bootstrap rearrangements.
Bootstrap values lower than 20% are not displayed in the
cladogram.
RNA isolation and hybridization
Fungal mycelia were harvested...
- 14
- 494
- 0
Báo cáo khoa học: Plant DNA polymerase k, a DNA repair enzyme that functions in plant meristematic and meiotic tissues docx
Ngày tải lên :
07/03/2014, 15:20
... Nagasawa, K., Kitamura, K., Yasui, A. , Nimura, Y., Ikeda, K.,
Hirai, M., Matsukage, A. & Nakanishi, M. (2000) Identification
and characterization of human DNA polymerase b2, a DNA
polymerase ... 5¢-AGCTACCATGCCT
GCACGAAGAGTGCGTATTATGCCTACACTGGA
GTACCGGAGCATCGTCGTGACTGGGAAAAC-3¢.
[
3
H]dTTP (10 l
M
;10CiÆmmol
)1
) and enzymes were added
as indicated in the figure legends, and incubated ... visualized by autoradiography.
DNA substrate used in this assay is a d15:d21-mer primer/
template. The sequences are 5¢-ACTGGAGATCTGC
AT-3¢ and 5¢-TGAAGCATGCAGATCTCCAGT-3¢.
Misincorporation assay
The...
- 9
- 492
- 0
Báo cáo khoa học: Purification of a plant nucleotide pyrophosphatase as a protein that interferes with nitrate reductase and glutamine synthetase assays pdf
Ngày tải lên :
08/03/2014, 08:20
... var. botrytis) extracts. The final
preparationcontainedanacyl-CoAoxidaseandasecond
protein of the plant nucleotide pyrophosphatase family. This
preparationhydrolysedNADH,ATPandFADtogenerate
AMP ... Sonoda, M., Ide, H., Nakayama, S., Sato, T. & Nakagawa, H.
(2000) Cloning and expression analysis of nitrate reductase
inactivator (NRI) gene from spinach. Plant Cell Physiol. 41, s160.
12. Kaiser,W.M.,Weiner,H.,Kandlbinder ,A. ,Tsai,C.B.,Rockel,
P., ... (v/v) HCl and 24%
(w/v) trichloroacetic acid. The A
504
was measured and the
c-glutamyl hydroxamate produced was quantified using
commercial c-glutamyl hydroxamate as standard. Control
assays were...
- 7
- 457
- 0
Báo cáo khoa học: Isolation and enzymatic characterization of lamjapin, the first ribosome-inactivating protein from cryptogamic algal plant (Laminaria japonica A) ppt
Ngày tải lên :
08/03/2014, 10:20
... ribosomal RNA by lamjapin were quantita-
tively analyzed by the chloroacetaldehyde method. A time
course study demonstrated that the release of adenine by
lamjapin continued at a linear rate for at ... the first
ribosome-inactivating protein from cryptogamic algal plant
(
Laminaria japonica
A)
Ren-shui Liu
1
, Jia-hua Yang
2
and Wang-Yi Liu
1
1
State Key Laboratory of Molecular Biology, Institute ... of rat ribosomal RNA
was flipped [27]. Lamjapin could deadenylate A2 0 of SRD
RNAandreleasedtheRNAfragmentwiththeexactsizeof
the R-fragment from the ribosomal RNA. It is likely that
lamjapin deadenylates...
- 7
- 479
- 0
