0

1 25 dihydroxyvitamin d as a bone anabolic agent

 Báo cáo y học:

Báo cáo y học: "1, 25-dihydroxyvitamin D3 decreases adriamycin-induced podocyte apoptosis and loss"

Y học thưởng thức

... related proteins including Fas, FADD, Bax and Bcl-2 and caspase-3 activity were detected Proteinuria can cause tubular cell apoptosis which is associated with activation of Fas-FADD-caspase pathway ... identified as 55 kDa, 60 kDa, 50 kDa, 25 kDa, 23 kDa, 26 kDa and 36 kDa, respectively The expressions of p-Smad2/3, p-Smad1/5/8, Fas, FADD, Bax, and Bcl-2 were 0.68±0 .10 , 1. 10±0.20, 0 .12 ±0.08, 0 .12 ±0.06, ... protein was normalized by that of GAPDH (36 kDa) as an endogenous reference Statistical Analyses Data were presented as means ± standard deviation (SD) Results were analyzed using the Kruskal-Wallis...
  • 10
  • 463
  • 0
Báo cáo khoa học:

Báo cáo khoa học: "Calcium metabolism in cows receiving an intramuscular injection of 1,25-dihydroxyvitamin D3 combined with prostaglandin F2?? closely before parturition" doc

Báo cáo khoa học

... 1, 25( OH) D group showed a marked increase in plasma Ca and iP 2 3 3 3 2 3 3 2 Effect of 1, 25- dihydroxyvitamin D3 and induced parturition in cows We thank Dr Azuma Watanabe (Mercian Corporation, Japan) ... continuous administration of 1, 25- dihydroxyvitamin D on plasma minerals and unoccupied mucosal 1, 25- dihydroxyvitamin D receptor concentrations J Dairy Sci 19 89, 72, 2936-29 41 Okura N, Yamagishi N, Naito ... mild decrease in plasma Ca and iP and a small rise in Mg level around calving Plasma concentrations of Ca (10 .3 ± 0.7 to 11 .5 ± 1. 0 mg/dl) and iP (6.0 ± 1. 9 to 7.9 ± 2 .1 mg/dl) in 1, 25( OH) D group...
  • 3
  • 223
  • 1
Success as a real estate agent for DUMmIES

Success as a real estate agent for DUMmIES

Đầu tư Bất động sản

... a trained agent, the 50/50 arrangement doesn’t change as drastically as it can in the residential arena ߜ You construct your own database Commercial real estate is a database business For example, ... training and because you didn’t secure the relationship or the deal, but rather had it handed to you (along with a base salary and company-provided administrative support and research assistance) ... should be available at the drop of a hat largely because agents have trained them to expect service 24 hours a day, days a week The National Association of Realtors ran a huge marketing campaign a...
  • 380
  • 902
  • 1
Báo cáo hóa học:

Báo cáo hóa học: " Designed hybrid TPR peptide targeting Hsp90 as a novel anticancer agent" docx

Hóa học - Dầu khí

... purchased from SIGMA All reagents were of reagent-grade quality Expression and purification of the TPR 2A domain of human Hop Strain and plasmid Surface plasmon resonance (SPR) Escherichia coli AD494 ... measured with a caliper, and the tumor volume (in mm3 ) was calculated using the following formula: length×width2×0.5 All values are expressed as the mean ± SD and statistical analysis was calculated ... carboxytetramethyl rhodamine (TAMRA)-labeled Antp-TPR (Antp-TPR-TAMRA) or TPR (TPR-TAMRA) as indicated Cells were then analyzed by phase-contrast (DIC), fluorescence (TAMRA-red) or merge image...
  • 12
  • 309
  • 0
Experimental investigation on a flat plate solar collector using al2o3 nanofluid as a heat transfer agent

Experimental investigation on a flat plate solar collector using al2o3 nanofluid as a heat transfer agent

Môi trường

... [11 ] [12 ] [13 ] [14 ] [15 ] [16 ] 329 GoharshadiE.K., Ahmadzadeh H., Samiee S., and Hadadian M Nanofluids for Heat Transfer Enhancement -A Review, Phys Chem Res., 2 013 ,1, 1, 1- 33 Masuda H., Ebata A. , ... karbala University E-mail address: abbasmarem@yahoo.com Mohammed Hassan Abbod Ass Prof Dr, Department of Mechanical Engineering, karbala University E-mail address: Malmussawie@yahoo.com Sura ... Thermocouple attached backside attached to second tube attached to forth tube attached outside, not shown in figure above attached inside collector 3 .1 The water as working fluid (base case) The Base case...
  • 14
  • 312
  • 0
Tài liệu Báo cáo khoa học: Mammalian Gup1, a homolog of Saccharomyces cerevisiae glycerol uptake/transporter 1, acts as a negative regulator for N-terminal palmitoylation of Sonic hedgehog doc

Tài liệu Báo cáo khoa học: Mammalian Gup1, a homolog of Saccharomyces cerevisiae glycerol uptake/transporter 1, acts as a negative regulator for N-terminal palmitoylation of Sonic hedgehog doc

Báo cáo khoa học

... (Promega, Madison, WT, USA) using the primers 5¢-CACACTACACTGGGAAGCAGAGACTCCAGC-3¢ and 5¢-AGCTGGCCCAGCAGCCATACACAGTTAAAG3¢ The cDNA was subcloned into the EcoRV site of pBluescript SK(+) (Stratagene, ... authors thank Drs Masato Yasui, Sadakazu Aiso and Masaaki Matsuoka for support; Dr Andrew P McMahon for providing the full-length mouse Shh cDNA; Dr Neil Cashman for providing NSC34 cells; Dr Tomohiro ... PCR products were separated by agarose gel electrophoresis followed by staining with ethidium bromide A fragment of glyceraldehyde-3phosphate dehydrogenase (GAPDH) was amplified as an internal control...
  • 14
  • 499
  • 0
Báo cáo khoa học: Alternative splicing: regulation of HIV-1 multiplication as a target for therapeutic action docx

Báo cáo khoa học: Alternative splicing: regulation of HIV-1 multiplication as a target for therapeutic action docx

Báo cáo khoa học

... CCAGUAGAUCCUAGACUAGA GAAGAAGCGGAGACAGCGACGAAGA AGAUCCAUUCGAUUAG unknown UAGUGAAUAGAGUUAGGCAGGGA GAAGAAGAA UAGAAGAAGAA 4995–5 017 [5, 12 , 38, 40] 5362–5366 5428–5437 5 418 –5437 5558–5582 8047–8062 [48, 41, 15 , 17 , ... GAR ESS3 hnRNP A1 ASF ⁄ SF2 hnRNP H hnRNP A1 SC35, SRp40 ASF ⁄ SF2, SRp40 hnRNP A1 , hnRNP E1 ⁄ E2 hnRNP A1 ASF ⁄ SF2 hnRNP A1 UUAGGACAUAUAGUUAGCCCUAGG unknown UGGGU CUAGACUAGA CCAGUAGAUCCUAGACUAGA ... Proc Natl Acad Sci USA 91, 7 311 –7 315 32 Kamata M, Nitahara-Kasahara Y, Miyamoto Y, Yoneda Y & Aida Y (2005) Importin-alpha promotes passage through the nuclear pore complex of human immunodeficiency...
  • 10
  • 434
  • 0
Báo cáo khoa học: Post-ischemic brain damage: targeting PARP-1 within the ischemic neurovascular units as a realistic avenue to stroke treatment pptx

Báo cáo khoa học: Post-ischemic brain damage: targeting PARP-1 within the ischemic neurovascular units as a realistic avenue to stroke treatment pptx

Báo cáo khoa học

... cycle and gene expression [23] Among PARPs, nuclear PARP -1 is a DNA damageactivated enzyme of 11 3 kDa molecular mass and is the most abundant and commonly studied member of the family Its enzymatic ... plasma and brain [40], prevents brain matrix degradation, reduces delayed increase of BBB permeability and edema formation, preserves endothelial tight junction proteins and decreases delayed ... from NADPH oxidase and mitochondria, sustained increase of the cytosolic Ca2+ concentration and finally nuclear translocation of mitogen-activated protein kinase kinase ⁄ extracellular regulated protein...
  • 10
  • 417
  • 0
Báo cáo khoa học: Purification and structural analysis of the novel glycoprotein allergen Cyn d 24, a pathogenesis-related protein PR-1, from Bermuda grass pollen pot

Báo cáo khoa học: Purification and structural analysis of the novel glycoprotein allergen Cyn d 24, a pathogenesis-related protein PR-1, from Bermuda grass pollen pot

Báo cáo khoa học

... AGAD AADA.NA.VG D. D 11 3 Zea AYA.S A- QRQG LI GG FW AGAD.SASDA.GS.VS QY.DHDT.S 11 2 Nicotiana AYA.N S-Q.AA NL HGQ AE -GDFMTAAKA.EM.V QY.DHD 11 8 Cyn d 24 DQGKMCGHYTAVVWKDTTSVGCGRVLCDDKKDTMIMCSYWPPGNYENQKPY ... Y.DA TA DVG.E DDQV 60 Cyn d 24 KFSQDYAESKLKKDCKMVHSDSPYGENLMFGSGAISWKTT VDTWSDEKKSYHYGSNTC 10 2 Hordeum A. A.N N-QRIN LQ GG IFW AGAD ASDA.NS.VS D. D 11 3 Triticum G .A. S N-QRIN LQ GG IFW AGAD AADA.NA.VG ... E GAG A GCC T ACC L TTG A GCC Y TAC E GAG D GAC H CAC D GAC Q CAG A GCA S AGC V GTC S TCC A GCT N AAC K AAG A GCG N AAC E GAG Y TAC D GAC K AAG L CTA K AAG Q CAG L CTC G GGC G GGG E GAG E GAG...
  • 10
  • 665
  • 0
Báo cáo khoa học: A (1fi3)-b-D-glucan recognition protein from the sponge Suberites domuncula Mediated activation of fibrinogen-like protein and epidermal growth factor gene expression pot

Báo cáo khoa học: A (1fi3)-b-D-glucan recognition protein from the sponge Suberites domuncula Mediated activation of fibrinogen-like protein and epidermal growth factor gene expression pot

Báo cáo khoa học

... (GLUBP_LITSTY, AF473579 -1) , the putative Gram-negative bacteria-binding proteins from the Diptera Anopheles gambiae (ENSAN1_ANGA, XP_ 312 118 .1) , (ENSAN5_ANGA, XP_ 312 116 .1) and (BACBP_ANGA, CAA04496 .1) , as ... tissue that had been incubated for day with 10 lgÆmL )1 curdlan, as described in the Materials and methods Extract from curdlan-treated tissue was size separated by SDS-PAGE (lane a) After separation, ... bacteria and malaria parasites Proc Natl Acad Sci USA 94, 11 508 11 513 19 Bachman, E.S & McClay, D. R (19 96) Molecular cloning of the first metazoan beta -1, 3 glucanase from eggs of the sea urchin...
  • 14
  • 299
  • 0
moving as a child part 1 conversation

moving as a child part 1 conversation

TOEFL - IELTS - TOEIC

... moved I was just about a teenager, so I know Kristin: Well, I, I’ve only moved once, too, when I was a child and I was eight And that was pretty tough for me Pennsylvania: a state in America Joe: ... Moving As A Child Part Conversation Kristin: Yeah comes a point: comes a time teenager: a person between 13 and 19 years old Joe: I mean, I’ve had some friends whose parents were in the Army and they ... never moved before so all my friends lived there And then I moved to Pennsylvania, rural Pennsylvania I mean, it was a complete… rural: area where there is a lot of farm land Kristin: Oh gosh culture...
  • 3
  • 408
  • 2
moving as a child part 1 ms

moving as a child part 1 ms

TOEFL - IELTS - TOEIC

... yet Did his dad join the Army? Yes, he did His dad joined the Army Whose dad joined the Army? Alex’s, Alex’s dad joined the Army Did Alex’s dad or Alex’s mom join the Army? His dad, his dad joined ... was rural Did the town that they moved to have a lot of farmland? Yes, it did It was rural, which is the same thing as saying it had a lot of farmland Rural means it had a lot of farmland Did they ... LLC Moving As A Child Part Mini-Story Lesson Yes, he did His dad joined the Army before he was born What did his dad do? He joined the Army, his dad joined the Army Did his dad join the Army or...
  • 16
  • 323
  • 3
moving as a child part 1 pov

moving as a child part 1 pov

TOEFL - IELTS - TOEIC

... Moving As A Child Part POV Lesson * * * * * Okay, so that is the story as if it is happening in the past; as if it has already happened Now let’s hear the story as if it is happening in ... I am twelve years old I am an army brat My dad joined the Army before I was born My parents and I lived on the moon for two years Then, out of the blue, we moved to America Right off the bat, ... story happening four years from now or, say, in four years Okay, here we go * * * * * In four years Alex’ll be twelve years old He’ll be an army brat His dad will join the Army Alex and his parents...
  • 3
  • 271
  • 1
moving as a child part 1 vocabulary

moving as a child part 1 vocabulary

TOEFL - IELTS - TOEIC

... difficult “from an educational standpoint.” Now educational standpoint… This is describing education For example: When I was a child and my family moved, we moved to an area that had much better ... Vocabulary Lesson Okay so getting back to the conversation… Joe is saying, “can actually be pretty traumatic to something like that as a kid.” To something such as that as a kid, or child And ... was almost a teenager And then I say, “Well, I, I’ve only moved once, too ” Or I’m saying I’ve only moved once also And I go on to say, “when I was a child and I was eight.” So I’m saying I was...
  • 9
  • 352
  • 2
Báo cáo sinh học:

Báo cáo sinh học: " Prevention of genital herpes in a guinea pig model using a glycoprotein D-specific single chain antibody as a microbicide" pptx

Điện - Điện tử

... Gamma Gamma Gamma Gamma Gamma Gamma Gamma Gamma 10 Gamma 11 Gamma 12 Gamma 13 Gamma 14 Gamma 15 Gamma 16 C region gamma primer Primer sequences used for PCR reactions GGTGATATCGTGATRACMCARGATGAACTCTC ... (gamma) Nomenclature Signal sequence/framework primers Kappa Kappa Kappa Kappa Kappa Kappa Kappa Kappa Kappa Kappa 10 Kappa 11 C region kappa primer Signal sequence/framework primers Gamma Gamma ... hybridomas, DL 11, DL6, DL2 and 1D3 An additional scFv, directed against carcinoembryonic antigen (CEA) served as an independent control Messenger RNAs from × 10 5 - 10 6 hybridoma cells were isolated...
  • 10
  • 541
  • 0
báo cáo hóa học:

báo cáo hóa học: " Methyl salicylate 2-O-b-D-lactoside, a novel salicylic acid analogue, acts as an antiinflammatory agent on microglia and astrocytes" docx

Hóa học - Dầu khí

... 47:589-596 doi :10 .11 86 /17 42-2094-8-98 Cite this article as: Lan et al.: Methyl salicylate 2-O-b -D- lactoside, a novel salicylic acid analogue, acts as an anti-inflammatory agent on microglia and astrocytes ... Iannitelli DAE, Cataldi A, Zara S, Nasuti C, Di Stefano A: Ibuprofen and Glutathione Conjugate as a Potential Therapeutic Agent for Treating Alzheimer’s Disease Arch Pharm (Weinheim) 2 010 Ray B, Lahiri ... Journal of Neuroinflammation 2 011 8:98 Received: April 2 011 Accepted: 11 August 2 011 Published: 11 August 2 011 References Maragakis NJ, Rothstein JD: Mechanisms of Disease: astrocytes in neurodegenerative...
  • 7
  • 409
  • 0
báo cáo hóa học:

báo cáo hóa học:" Prevention of genital herpes in a guinea pig model using a glycoprotein D-specific single chain antibody as a microbicide" pdf

Hóa học - Dầu khí

... Gamma Gamma Gamma Gamma Gamma Gamma Gamma Gamma 10 Gamma 11 Gamma 12 Gamma 13 Gamma 14 Gamma 15 Gamma 16 C region gamma primer Primer sequences used for PCR reactions GGTGATATCGTGATRACMCARGATGAACTCTC ... (gamma) Nomenclature Signal sequence/framework primers Kappa Kappa Kappa Kappa Kappa Kappa Kappa Kappa Kappa Kappa 10 Kappa 11 C region kappa primer Signal sequence/framework primers Gamma Gamma ... hybridomas, DL 11, DL6, DL2 and 1D3 An additional scFv, directed against carcinoembryonic antigen (CEA) served as an independent control Messenger RNAs from × 10 5 - 10 6 hybridoma cells were isolated...
  • 10
  • 401
  • 0
báo cáo hóa học:

báo cáo hóa học:" Engagement of patients in religious and spiritual practices: Confirmatory results with the SpREUK-P 1.1 questionnaire as a tool of quality of life research" ppt

Hóa học - Dầu khí

... humanistic practice disease duration of disease disease * duration of disease 0.053 2.047 1. 711 3 .18 8 0.0 91 n.s 0.002 (5) nature-oriented practice SpR attitude age disease duration of disease 0.000 ... status, educational level, religious affiliation, SpR attitude, disease and duration of disease Using the method of univariate analyses of variance we identified several sources of variability (Table ... manual (Version 1. 1) are currently available in English and German Authors' contributions AB conceived the study, designed and developed the questionnaire, performed statistical analysis and drafted...
  • 11
  • 425
  • 0
báo cáo hóa học:

báo cáo hóa học: " F-fluoride PET: changes in uptake as a method to assess response in bone metastases from castrate-resistant prostate cancer patients treated with 223Ra-chloride (Alpharadin)" pdf

Hóa học - Dầu khí

... biochemical markers including PSA as a tumour marker and ALP as a bone formation marker Methods This imaging study was performed as a pilot substudy of an open-label phase trial of Alpharadin in patients ... manuscript drafting and approval VL study design, data acquisition, analysis, manuscript drafting and approval Competing interests CP is a consultant to Algeta ASA Received: 17 January 2 011 Accepted: June ... Med 19 88, 29 :13 54 -13 59 doi :10 .11 86/ 219 1- 219 X -1- 4 Cite this article as: Cook et al.: 18 F-fluoride PET: changes in uptake as a method to assess response in bone metastases from castrate-resistant...
  • 6
  • 286
  • 0
3 ĐỀ THI THỬ ĐẠI HỌC CAO ĐẲNG NĂM 2010-LẦN 1  Môn thi: TOÁN – Khối A ,B,D và đáp án

3 ĐỀ THI THỬ ĐẠI HỌC CAO ĐẲNG NĂM 2010-LẦN 1 Môn thi: TOÁN – Khối A ,B,D và đáp án

Toán học

... TC MC TD AP QD DP CP = = ⇒ AT / / DP ⇒ = = = Mà: TC AC QA AT CA VA PQN AP AQ 1 = = = ⇒ VA.PQN = VABCD (1) Nên: VA.CDN AC AD 5 10 VC PMN CP CM 1 = = = ⇒ VABMNP = VABCD (2) Và VC ABN CA CB ... đoạn 15 Gọi O giao điểm AC BD ⇒ SO ⊥ ( ABCD ) Ta có: SO = SA2 − OA2 = a − 0 ,25 đ1 − ;  )   ( 2a 2 a+ a ) = a ( ) 1 0 ,25 đ 0 ,25 đ 2a a = S ABCD = a ⇒ VS ABCD = a Gọi M, N trung điểm AB ... = 1( l ), t = −3(l ) a2 ab ab =a a = a ab (1) Ta có: a+ b a+ b 2 ab D a vào BBT, ta kết luận m ≥ Ý2 (1, 0đ) b2 c2 ≥b− bc (2), ≥c− ca (3) b+c c +a Cộng (1) , (2), (3), ta có: a2 b2 c2 + + + ab...
  • 12
  • 323
  • 0

Xem thêm

Tìm thêm: xác định các mục tiêu của chương trình xác định các nguyên tắc biên soạn khảo sát chương trình đào tạo của các đơn vị đào tạo tại nhật bản khảo sát chương trình đào tạo gắn với các giáo trình cụ thể xác định thời lượng học về mặt lí thuyết và thực tế tiến hành xây dựng chương trình đào tạo dành cho đối tượng không chuyên ngữ tại việt nam khảo sát thực tế giảng dạy tiếng nhật không chuyên ngữ tại việt nam khảo sát các chương trình đào tạo theo những bộ giáo trình tiêu biểu xác định mức độ đáp ứng về văn hoá và chuyên môn trong ct phát huy những thành tựu công nghệ mới nhất được áp dụng vào công tác dạy và học ngoại ngữ mở máy động cơ rôto dây quấn các đặc tính của động cơ điện không đồng bộ đặc tuyến mômen quay m fi p2 đặc tuyến tốc độ rôto n fi p2 đặc tuyến dòng điện stato i1 fi p2 sự cần thiết phải đầu tư xây dựng nhà máy thông tin liên lạc và các dịch vụ phần 3 giới thiệu nguyên liệu từ bảng 3 1 ta thấy ngoài hai thành phần chủ yếu và chiếm tỷ lệ cao nhất là tinh bột và cacbonhydrat trong hạt gạo tẻ còn chứa đường cellulose hemicellulose chỉ tiêu chất lượng theo chất lượng phẩm chất sản phẩm khô từ gạo của bộ y tế năm 2008