Genome Biology 2007, 8:209 Protein family review The ring between ring fingers (RBR) protein family Birgit Eisenhaber*, Nina Chumak † , Frank Eisenhaber* and Marie-Theres Hauser † Addresses: *Research Institute of Molecular Pathology (IMP), Dr Bohr-Gasse, A-1030 Vienna, Austria. † Institute of Applied Genetics and Cell Biology, Department of Plant Science and Plant Biotechnology, University of Natural Resources and Applied Life Sciences, Muthgasse, A-1190 Vienna, Austria. Correspondence: Birgit Eisenhaber. Email: Birgit.Eisenhaber@imp.univie.ac.at. Marie-Theres Hauser. Email: Marie-Theres.Hauser@boku.ac.at Summary Proteins of the ring between ring fingers (RBR)-domain family are characterized by three groups of specifically clustered (typically eight) cysteine and histidine residues. Whereas the amino- terminal ring domain (N-RING) binds two zinc ions and folds into a classical cross-brace ring finger, the carboxy-terminal ring domain (C-RING) involves only one zinc ion. The three- dimensional structure of the central ring domain, the IBR domain, is still unsolved. About 400 genes coding for RBR proteins have been identified in the genomes of uni- and multicellular eukaryotes and some of their viruses, but the family has not been found in archaea or bacteria. The RBR proteins are classified into 15 major subfamilies (besides some orphan cases) by the phylogenetic relationships of the RBR segments and the conservation of their sequence architecture. The RBR domain mediates protein-protein interactions and a subset of RBR proteins has been shown to function as E3 ubiquitin ligases. RBR proteins have attracted interest because of their involvement in diseases such as parkinsonism, dementia with Lewy bodies, and Alzheimer’s disease, and in susceptibility to some intracellular bacterial pathogens. Here, we present an overview of the RBR-domain containing proteins and their subcellular localization, additional domains, function, specificity, and regulation. Published: 15 March 2007 Genome Biology 2007, 8:209 (doi:10.1186/gb-2007-8-3-209) The electronic version of this article is the complete one and can be found online at http://genomebiology.com/2007/8/3/209 © 2007 BioMed Central Ltd Gene organization and evolutionary history The ring between ring fingers (RBR) proteins are a large and diverse group of proteins characterized by a compact sequence module that is predicted to form three ring finger-type, or ‘ring’, domains separated by loops [1,2]. The RBR domain usually occurs as part of a multidomain protein with diverse functional modules, and appears to mediate protein-protein interaction. The function of most of the family members has not yet been explored experimentally, but a subset of RBR proteins is known to have E3 ubiquitin ligase activity. The sequence of each ring domain in the RBR region contains a cluster of, typically, eight cysteine and histidine residues that potentially bind metal ions. The amino-terminal ring domain (RING1 or N-RING) is thought to bind two zinc ions and to fold into a classical cross-braced ring finger, whereas the carboxy-terminal ring (RING2 or C-RING) appears to bind only one metal ion and forms a hydrophobic core different from that of classical ring fingers [3]. The central cysteine/histidine cluster is likely to also form a ring finger- type structure. Morett and Bork [4] derived a general sequence profile-based characterization of this domain and called it IBR (in between rings). Independently, van der Reijden et al. [5] identified this domain - with a more restricted PROSITE-like pattern [6] C 6 HC - as DRIL (double ring finger linked) domain, and called the family of RING- DRIL-RING-containing proteins TRIAD. The two definitions are largely overlapping but not identical. The approach of Morett and Bork [4] is consistent with the concept of sequence homology and the criterion of statistically significant sequence similarity and is therefore the preferred one. RBR proteins make up a large, diverse family with, at present, around 400 representatives in sequence databases. On the basis of sequence conservation within the RBR segment, RBR proteins are assigned to 15 subfamilies (A-I, P, S, T, U, X, Z; Figure 1). There are also some 10 orphan sequences that could be considered as their own groups. Subfamily A (Ariadne-like proteins) can be further sub- divided into around 10 clusters (A0-A9). Similarly, several subgroups can be distinguished for subfamilies S (found only in viruses), T (the TRIAD3 proteins), and Z (found only in protozoa). The alignment of RBR segments from sequence representatives of the various groups is shown in Figure 1 and details with respect to the conservation of the cysteine/ histidine pattern and loop sizes are given in Additional data file 1, available online with this article. Additional information (sequence lists, subgroup alignments, annotations, and supplementary text and tables) is also available at our website [7]. Genome sequencing projects have added considerably to the information on RBR genes; they comprise a complex and ancient gene family that has been found in all eukaryotes examined and in some of their viruses. There are two RBR proteins in the yeast Saccharomyces cerevisiae, six in Drosophila melanogaster, 10 in Caenorhabditis elegans, about 40 in Arabidopsis thaliana, around 23 in the zebrafish (Danio rerio), and about 15 in humans (Additional data file 1). Genes of RBR proteins are dispersed throughout the genome. They vary in chromosomal location and exon number. For example, Mladek et al. [8] have studied the Ariadne (A) subfamily in Arabidopsis: the 16 AtARI genes are distributed between all five chromosomes at 10 loci. Despite the conserved sequence, they have distinct gene 209.2 Genome Biology 2007, Volume 8, Issue 3, Article 209 Eisenhaber et al. http://genomebiology.com/2007/8/3/209 Genome Biology 2007, 8:209 Figure 1 Multiple alignment of RBR domain segments. The figure includes the sequences of 64 representative RBR segments. This alignment is part of the grand alignment used to create the phylogenetic tree in Figure 2. The sequence identifier gives the subfamily code (first letter) followed by the taxon and the accession number in GenBank. The loop segments between the three ring-like domains are indicated by ‘XX’. The gray bars at the bottom represent the degree of amino acid type conservation of alignment positions. The alignment was primarily generated with CLUSTALX [70] and edited manually. Taxon abbreviations: Am, Apis mellifera; At, Arabidopsis thaliana; Ce, Caenorhabditis elegans; Dd, Dictyostelium discoideum; Dm, Drosophila melanogaster; Dr, Danio rerio; Gz, Gibberella zeae; Hs, Homo sapiens; Nc, Neurospora crassa; Sp, Schizosaccharomyces pombe. * * * * * * * XXX * * * * * * * * XX * * . * . * * * AAm|XP_396912.1| CGICFTIQP SAMMTGLE-CGHR-FCTGCWGEYLTTKIMEEGVGQT IACAA HACDIL-XX-RWCPS-PDCNNAIK VQYVEARP VTCK CGHT-FCFHCGE NWHDPVK-CHLLR-XX-KECPKCNVTIEKD-GG-CNHMVCKNQ NCKTDFCWVC 140 AAm|XP_624643.1| CSVCVAIYS AEKFSTLT-CGHS-FCKDCWCMHFEVQITQ-GISTG ISCMA QDCNVL-XX-RFCPG-PNCQMIMRSK-EQRAKR VMCSS CKTV-FCFRCGI DYHAPTD-CNTMK-XX-KDCPKCHICIEKN-GG-CNHMQCYN CKYDFCWMC 138 AAt|NP_189408.1| CDVCMEDDLP-SNVMTRME-CGHR-FCNDCWIGHFTVKINE-GESKR ILCMA HECKAI-XX-KWCPSKPHCGSAIRKI-EDGHDVVEV GCS CGLQ-FCFSCLS ESHSPCS-CLMWK-XX-KLCPKCSKPIQKR-DG-CNLMTCK CGQHFCWLC 140 AAt|NP_567966.1| CDVCMEDL-P-GDHMTRMD-CGHC-FCNNCWTEHFTVQINE-GQSKR IRCMA HQCNAI-XX-KWCPSTPHCGNAIRAE-DD KLCEV ECS CGLQ-FCFSCLC QAHSPCS-CLMWE-XX-KLCPKCYKPVEKN-GG-CNLVRCI CGQCFCWLC 137 AAt|NP_179206.2| CDICVEDV-P-GYQLTRMD-CGHS-FCNNCWTGHFTVKINE-GQSKR IICMA HKCNAI-XX-KWCPSTPHCGNAIRVE-DD ELCEV ECS CGLQ-FCFSCSS QAHSPCS-CVMWE-XX-KPCPKCHKPVEKN-GG-CNLVTCL CRQSFCWLC 137 ACe|AAB93645.3| CDICCSLG E-LSGLS-CNHR-ACTQCWKAYLTNKIANNAQSE IECMA PNCKLL-XX-KWCPG-IDCGKAVR VSHWEPRL VVCS CGSR-FCFSCGH DWHEPVN-CRLLK-XX-KECPKCMITIEKD-GG-CNHMTCKNT ACRFEFCWMC 136 ACe|AAB93643.1| CDICCSMD E-LSGLS-CNHR-ACAECWQAYLTNKIVSDAQSE IECMA PNCKLL-XX-RWCPG-IDCGKAVK VSHWEPRL VVCS CGTC-FCFSCGQ NWHEPLN-CRHLK-XX-KDCPKCMIPIEKN-GG-CNRMLCTNS GCRYEFCWMC 136 ACe|AAB93644.1| CDICCSMD E-LSGLS-CNHR-ACAECWQAYLTNKIVSDAQSE IECMA PNCKLL-XX-KWCPG-VDCGRTVK VSHGEPRL VVCT CGSR-FCFSCGQ DWHEPVN-CRLLK-XX-KECPKCMATIEKN-GG-CNQITCKNT GCKFQFCWMC 136 ACe|AAB03121.2| CSVCAMDG YTELPHLT-CGHC-FCEHCWKSHVESRLSE-GVASR IECME SECEVY-XX-KFCVG-NECPVIIRST-EVKPKR VTCMQ CHTS-FCVKCGA DYHAPTS-CETIK-XX-KDCPQCHSCIEKA-GG-CNHIQCTR CRHHFCWMC 137 ACe|CAB70234.1| CDVCCSMT R-LSGLA-CAHR-ACDECWKAYLTEKIVDVGQSE IECMM MDCKLL-XX-KWCPG-AGCGKAVKGE-PSDREP AVCT CGER-FCFACAQ DWHDPLS-CRHMK-XX-KPCPKCSVTIEKN-GG-CNHMSCKSS SCRYEFCWLC 136 ADd|XP_636442.1| CLVCFSDVTK QKAYSLQ-CNHS-YCIDCWYSYLAISVDS-GKTCL-YTKCIE PNCKYV-XX-RWCTNPQSCSMAIHYSGVDLPNIIN VTCS CNWR-FCFHCGD EYHTPST-CVQVS-XX-KKCPKCKIHIEKN-EG-CAHLTCLN CKHEFCWLC 142 ADd|XP_637482.1| CLICLEDYP PTQTFALI-CNHR-YCLPCYKNYLEIKVSEGPECIY TPCPA PKCKVI-XX-KWCPA-PGCIYSIRCD-RK ERKEA VNCK CGFQ-YCFNCNDYEIGDHMPCP-CSQVD-XX-KKCPECRSPIEKN-GG-CMHMTCRKNAGGCGFEFCWLC 146 ADd|XP_643727.1| CIVCFENQSN-DDSFYSLS-CGHGPYCKGCWKSYLHQEMQTCGGEII-HSKCIY PLCNGK-XX-EFCPNP-SCGNAIRYSGVGRPNDV VECH CGTR-FCFSCGS EKHNPVS-CAQLV-XX-KPCYHCGMPTERI-MG-CNHIICRKEQGGCGGEWCWMC 147 ADm|AAN11912.1| CGICFCSC DE-LIGLG-CGHN-FCAACWKQYLANKTCSEGLANT IKCPA ANCEIL-XX-RWCPA-PNCSHAVK AVCAEPRA VLCK CGHE-FCFACGE NWHEPAS-CSSLK-XX-KECPKCNVTIEKD-GG-CNHMVCKNP SCRYDFCWVC 138 ADm|AAS65398.1| CEICFSQLP PDSMAGLE-CGHR-FCMPCWHEYLSTKIVAEGLGQT ISCAA HGCDIL-XX-RWCPS-VDCTYAVK VPYAEPRR VHCK CGHV-FCFACGE NWHDPVK-CRWLK-XX-KECPRCSVTIEKD-GG-CNHMVCKNQ NCKNEFCWVC 140 ADm|AAF46823.1| CPVCASSQL GDKFYSLA-CGHS-FCKDCWTIYFETQIFQ-GISTQ IGCMA QMCNVR-XX-RFCPG-PNCQIIVQSS-EISAKR AICKA CHTG-FCFRCGM DYHAPTD-CQVIK-XX-KDCPKCHICIEKN-GG-CNHMQCFN CKHDFCWMC 138 ADr|AAH53248.1| CGVCLQLVR RDALLSLP-CQHS-FCKGCWEQHCTVLVKD-GVGVE ISCMA QDCSLR-XX-QLCPG-ADCPIVIQVQ-EPRARR VQCSR CEEV-FCFKCRQ MYHAPTD-CATIR-XX-KDCPKCNICIEKN-GG-CNHMQCSK CKHDFCWMC 138 ADr|AAH67684.1| CQICYLNYP NSYFTGLE-CGHK-FCMQCWGDYLTTKIIEEGMGQT ISCPA HNCDIL-XX-KWCPA-PDCHHVVK VQYPDAKP VRCK CGRQ-FCFNCGE NWHDPVK-CKWLR-XX-KECPKCHVTIEKD-GG-CNHMVCRNQ NCKAEFCWVC 140 ADr|XP_687241.1| CQICYLNYP NSYFTGLE-CGHK-FCMQCWGDYLTTKIIEEGMGQT ISCPA HSCDIL-XX-KWCPA-PDCHHVVK VQYPDAKP VRCK CGRQ-FCFNCGE NWHDPVK-CKWLR-XX-KECPKCHVTIEKD-GG-CNHMVCRNQ NCKAEFCWVC 140 AGz|EAA76603.1| CDICCEDDD GLESFAMK-CGHR-YCVDCYRHYLTQKIREEGEAAR IQCPS DGCGRI-XX-KWCPA-PDCPNALECG-VKKKDLGRIVPT-VECR CGFR-FCFGCPN PDHQPAP-CDLVK-XX-KECPKCNSTIEKN-GG-CNHMTCR KCKYEFCWMC 144 AHs|AAH00422.1| CAVCMQFVR KENLLSLA-CQHQ-FCRSCWEQHCSVLVKD-GVGVG VSCMA QDCPLR-XX-QLCPG-ADCPMVIRVQ-EPRARR VQCNR CNEV-FCFKCRQ MYHAPTD-CATIR-XX-KDCPKCNICIEKN-GG-CNHMQCSK CKHDFCWMC 138 AHs|NP_055904.1| CPVCVSPLGC-DDDLPSLC-CMHY-CCKSCWNEYLTTRIEQ-NLVLN CTCPI ADCPAQ-XX-TWCTNPQGCDRILCRQ-GLGCGT TCSK CGWA-SCFNCSFP EAHYPAS-CGHMS-XX-KRCPSCQAPIEKN-EG-CLHMTCAK CNHGFCWRC 140 AHs|AAH51877.1| CQICYLNYP NSYFTGLE-CGHK-FCMQCWSEYLTTKIMEEGMGQT ISCPA HGCDIL-XX-KWCPA-PDCHHVVK VQYPDAKP VRCK CGRQ-FCFNCGE NWHDPVK-CKWLK-XX-KECPKCHVTIEKD-GG-CNHMVCRNQ NCKAEFCWVC 140 ANc|XP_327168.1| CDICCEDGD GLESFAIK-CGHR-YCVDCYRQYLSQKIREEGEAAR IQCPA DGCNLI-XX-KWCPS-PDCANAVECG-VKKKDLTKVVPT-VSCL CGHR-FCFGCIY TDHQPAP-CELVK-XX-KECPKCNSTIEKN-GG-CNHMTCR KCKYEFCWMC 144 ASp|CAB95997.1| CEICYDEG CLPFFSAE-CDHE-FCLACYRQYLDSRISE-GESV IQCPE ESCTQI-XX-RWCPA-PDCEFAIECH-VTQASLSSVVPT-VTCN CGKQ-FCFGCGH DNHQPTI-CPLVK-XX-KECPKCSTTIEKN-GG-CNHMTCK KCKYEFCWVC 141 BAm|XP_624683.1| CKICFVDKI GEHCTQFLPCGHI-FCKDCITGYLEVRIKDGN-VQ NIYCPEE KCTS XX-VYCPR-RSCQYPVSR EPN EQMA NCPI CQYA-FCVYCKM VYHG-IEPCKVYS-XX-QKCPKCQAAIEKS-DG-CNKMVCWR CNTFFCWLC 137 BAt|NP_174512.1| CCICFSES AGIDFVKL-PCQHF-FCLKCMKTYTDIHVTEGT-VN KLKCPDSK CGE XX YCPR CETPCIED EEQ L ALCFK CYFS-FCTLCKE KRHVGVA-CMSPE-XX-KQCPSCKIAISRT-GG-CNKMVCNN CGQYFCYRC 132 BCe|AAB52683.1| CQVCFESQM GQHCIKFQPCSHV-FCKSCTFNYY-ISIAKGF-VSKP-MSCLAE GCENE-XX-MECPN-ENCQMVAYLT DSQ RNL VECSY CNYS-FCNLCKG TFHG-VSRCKFRK-XX-KQCPKCLVYIEKD-EG-CNKMHCTK CNASFCWLC 139 BDr|NP_001002087.1| CGICYSEKL GCDCLLFKECEHV-YCKACIKEYFQIQIKDGK-VQ CLNCPEP KCAS XX-VYCPR-MSCCMAVMV EPDSTMG ICPS CRYA-FCTLCRR SYHG-LSHCIATA-XX-KQCPCCGTNIQKA-HG-CNKMTCSS CQKYFCWIC 137 BDr|XP_687162.1| CGICFTENL GSSFVLFNECQHV-YCKTCVKDYFEIQIKDGK-VQ FLSCPEA ECTS XX-VYCPR-KSCGMAVML EPDRTMG ICPS CKFV-FCTLCNR VYHA-LALCNES XX-KQCPTCGVKIQKD-MG-CDMMTCSS CQQFFCWTC 136 BHs|NP_899648.1| CSICFCEKL GSECMYFLECRHV-YCKACLKDYFEIQIRDGQ-VQ CLNCPEP KCPS XX-VYCPR-PCCQLPVMQ EPGCTMG ICSS CNFA-FCTLCRL TYHG-VSPCKVTA-XX-KSCPCCGTPIEKL-DG-CNKMTCTG CMQYFCWIC 137 BSp|CAB65614.1| CNVCFDEFN GTDCFQLTRCGHV-SCQSCLRDYYTMCIQEGM-FSQ IKCIDL DCGKD-XX FCPR-SFCQGPSKRD PGQK LA ICQK CDFA-FCSFCQAT WHGDLSPCKLEG-XX-QRCPTCDRVVERI-DG-CCHMNCL CGTHFCFLC 137 CAm|XP_393708.2| CKLCLVDTS-LSK-TFKIEGCGCS-YCKDCMKAYIEFEIEEG AY EISCPD AQCEH XX-AWCPR-AGCETICSINS-TGSNGTPIGP VHCPN CSID-FCSICRE SWHTG PCSDIS-XX-KCCPMCSVPIEKD-EG-CAQMMCKR CKHVFCWYC 141 CDr|AAH76084.1| CKLCLGEFP-LEQ-MTTISQCQCI-FCSLCLKQYVELLIKEGL-ET AISCPD SACPK XX-TWCPS-SSCQAVCQLNE AEVQLPQP VQCPE CSLR-FCSACRA DCHTGQA-CQEML-XX-KRCPKCKVYIERD-EG-CAQMMCKN CKHAFCWYC 141 CDr|CAI20730.1| CKLCLGEFP-LEQ-MTTITQCQCV-FCTMCLKQYVELLIKEGF-ET AISCPD SACPK XX-TWCPS-STCQAVCQLKE SDTVLPQL VRCSV CTLE-FCSACKA SWHPDQD-CQENV-XX-KRCPKCKVYIERD-EG-CAQMMCKN CKHAFCWYC 141 CHs|AAH50373.1| CKLCLGEYP-VEQ-MTTIAQCQCI-FCTLCLKQYVELLIKEGL-ET AISCPD AACPK XX-TWCPA-STCQAVCQLQDVGLQTPQP VQCKA CRME-FCSTCKA SWHPGQG-CPETM-XX-KRCPKCKVYIERD-EG-CAQMMCKN CKHAFCWYC 141 CHs|NP_877434.2| CKLCLCEQS-LDK-MTTLQECQCI-FCTACLKQYMQLAIREGC-GS PITCPD MVCLN XX-TWCPV-ADCQTVCPVA-S-SDPGQPVL VECPS CHLK-FCSCCKD AWHAEVS-CRDSQ-XX-KQCPVCRVYIERN-EG-CAQMMCKN CKHTFCWYC 141 DAm|XP_623728.1| CPLCLAEL-PMEF-FPVVQSCHHR-SCYDCYQQYLKVEISESR V NIACP ECSEP-XX-RWCPA-PDCSFAVIASGCASCP-K LRCERPGCDSY-FCYHCKA RWHPNQT-CDAAR-XX-KPCPRCQVLIVKMDDGSCNHMVCAV CGAEFCWLC 141 DCe|AAK68189.1| CPLCAAKM-PGSA-FPKLKGCQHR-SCRACLRQYVELSITENR V EVPCP ECSSY-XX-RWCPA-PDCGFVFIATKCAACP-Q LKCQRPDCGTL-FCYHCKR EWHSNQT-CDEAR-XX-KACPRCKTYIVKMDDGSCNHMVCTM CNAEFCWLC 141 DDr|CAI21211.1| CPLCLLSQ-PRAH-FPRLSSCQHR-ACTDCLRQYLRIEISESR V GIACP QCPEA-XX-RWCPA-PDCSYAVIAYGCAECP-K LSCGREGCETE-FCYHCRQ LWHPDQT-CDQAR-XX-KPCPRCGAYIMKTNDGSCNRMNCTV CACQFCWLC 141 DDr|XP_690873.1| CPLCLVRQ-PAEQ-LPELQGCSHR-SCLCCLRQYLRIEITESR V QLSCP ECAER-XX-RWCPA-PDCGFAVIASGCASCP-R LVCRREGCGAE-FCYHCKQ AWHPNQT-CDSAR-XX-KPCPRCGAYIIKMNDGSCNHMTCAV CGCEFCWLC 141 DHs|NP_904355.1| CPLCLLRH-SKDR-FPDIMTCHHR-SCVDCLRQYLRIEISESR V NISCP ECTER-XX-RWCPA-PDCGYAVIAFGCASCP-K LTCGREGCGTE-FCYHCKQ IWHPNQT-CDAAR-XX-KPCPRCAAYIIKMNDGSCNHMTCAV CGCEFCWLC 141 EGz|EAA77947.1| CSVCFGEAEES LETS CGHI-YCNICFVNMCQSGESS-S-GDFS-IKCVG ASDACKKI-XX-RYCPT-PDCDQVYRVS SPEK VPFM FTCSR CFTS-TCTACNAS HPG-ISCSKNK-XX-KDCPKCTTAIQKS-EG-CNHMTCFA CRTHICWVC 139 FGz|EAA76086.1| CIACAESA HG RA-PCGCN-YCVTCYRQIIRIGLRS QEEFPPKC CK XX-VYCYQ-GNCAAFIPP DLKG RCPI CPYK-TCVDCGEK AHDGWP-CAEGD-XX-VNCPDCGRMIQLS-EA-CNHMTCP CGGEFCFLC 123 FGz|EAA77041.1| CGGCMNDFPE-DETAVMA CTHE-FCEPCFSLMIERSLDG SSAFPPRC CDI XX-TYCSN-VECQTFIPPW-TIESD I GYCPS CPQR-TCAKCKNPE HTGR C XX-KPCPRCGQLINKT-SG-CEHVICP CGNEFCFHC 127 FGz|EAA77042.1| CLACGEDFPQ-SS-MIFAP-CSHL-FCKPCADNLVSLAMRD EAYFPARC CDT XX-VYCSS-EICATFIPPT-QIDSG I GHCKR CLTD-TCIACKAKA HEGV CG XX-KRCSKCGHVIEKS-MG-CDHMVCL CGHRFCYAC 128 GAt|NP_180108.1| CSICFEETEG-ERMFFTTEKCVHR-HCFPCVKQYVEVKLLSGT V PT-CLDDG CKF XX-IYCPY-PNCSMLMSKT-ELSSESDLSN-D-RSCVK CCGL-FCIDCKVPS HSDLS-CAE XX-RQCKMCRHMIELS-HA-CNHMTC RCGYQFCYQC 139 GAt|NP_179737.1| CCICRENTDA-DRMFF-TENCFHR-QCFSCVNRHVQRMLLCGI S PT-CLHFP CNS XX-IYCPY-RRCSMLMSKT-ALSRETDQSN-V-RACIK CCRL-FCIDCKVPS HAGLS-CVD XX-RQCVQCSNLVELF-EG-CNHITC RCGFEFCYVC 138 GAt|NP_190133.1| CVICLEETKA-DRMFV-MDKCLHR-HCYPCVNQLVEVKLRNGT V PT-CLDYE CKL XX-IYCPY-INCSTLMSKT-EIS-RSNKSN-D-RACIK CSGL-VCIDCKVPW HSDLS-CAE XX-RQCVKCRHLIELN-QG-CNHMTC RCGYQFCYKC 137 GAt|NP_190140.1| CKICLDDDIN-ENQMFCVGKCRHR-FCSDCMRRHIEVRLLEGS V MR-CPHYR CKT XX-IYCPN-SRCSALMSET-ELSISTKEDEVR-RCCFK CGQI-FCIKCKVSW HSNLS-CND XX-RQCGKCQHMIELS-KG-CVQVKC RCGHKFCYRC 140 GAt|NP_190144.1| CSICSDDNFE-PELMFSVALCGHE-FCVECVKRHIEVRLLAGG V PR-CLHYQ CES XX-VYCPN-PRCSSLMSVT-KLSNSTREDVTM-RSCVK CGEP-FCINCKLPW HSNLS-CND XX-RQCENCKNVIELS-EG-CMHITC RCGHQFCYKC 140 GAt|NP_190937.1| CEICVDSKSIIES-FR-IGGCSHF-YCNDCVSKYIAAKLQDNI L SIECPVSG CSG XX-FYCPY-KDCSALVFLE-ESEVKMKDSE CPH CHRM-VCVECGTQW HPEMT-CEE XX-KRCPSCKFYIEKS-QG-CLYMKC RCGLAFCYNC 136 GAt|NP_973536.1| CTICFDDDIN-ADMMFYIDQCGHM-FCSECVKRHIEVSLLQGS L IT-CPSYR CKS XX-VYCPN-PTCSALMSVT-ELDQLTGS KRCCVK C-GESFCIKCKVPW HDNLS-CKR XX-RQCSKCKHMIELT-QG-CVRVIC RCGHEFCYGC 137 GAt|BAB08302.1| CSICSDKTDA-EHMLL-NDKCLHR-HCFSCVKQQVKVKLRSGI V PP-CLEDG CKS XX-IYCPY-RSCSMLMSKT-ELSREAEQSN VRACIK CSEL-FCIDCKVPW HSDLS-CAD XX-RQCSECKHMIELT-EG-CNHITC RCGYEFCYRC 138 HAt|NP_567206.1| CPICLSEVDD-G-YSLE GCSHL-FCKACLLEQFEASMRN-FDAFP ILCSH IDCGAP-XX-RFCST-PDCPSIYRVA GPQE SGEP FICGA CHSE-TCTRCHLE YHP-LITCERYK-XX-KECPICKSTIEKT-DG-CNHLQCR CGKHICWTC 138 HAt|NP_196599.2| CPICLSEVDD-G-YSLE GCSHL-FCKACLLEQFEASMRN-FDAFP ILCSH IDCGAP-XX-RFCST-PDCPSVYRVA GPQE SGEP FICGA CHSE-ICTRCHLE YHP-LITCERYK-XX-KECPICKSTIEKT-DG-CNHMKCR CGKHICWTC 138 UAm|XP_393719.2| CELCTGRFAM-SQ-IVSMLKCIHR-CCNECAKNYFTIQISDRN-IT DAVCPF C XX-KWCIQ CSSG FYADP DQKR LICPD CRSV-TCAQCRRPWEKQHEGIT-CEQ XX DCPKCKFRYSLS-RGGCMHFTCS QCKYEFCCGC 132 UDr|XP_696033.1| C-ICLCSPPQ MVTMTHCSCT-FCESCFKKYFSSVIKEKN-IV HAVCPL C XX-RWCAH CCFG LLHEA DRLR MDCPS CGKS-TCFKCKRPWAPQHEGIS-CEK XX DCPKCKFRFFLA-RGGCLHFRCT QCQHEFCGGC 129 UHs|AAH12077.1| CAVCGWALPH-NR-MQALTSCECT-ICPDCFRQHFTIALKEKH-IT DMVCPA C XX-LWCAQ CSFG FIYER EQLE ATCPQ CHQT-FCVRCKRQWEEQHRGRS-CED XX DCPKCKFSYALA-RGGCMHFHCT QCRHQFCSGC 132 XAm|XP_393942.2| CPVCFVTYGP-REGVILR-DCLHM-FCRSCIANTIRYCEEA EV KCPYRDSEYTCES XX-FHCKT-PDCPGWCIYD DDVN NFLCPV CGAN-NCLTCQAI HTGKN-CKQYQ-XX-LACPTCAVVLMKK-WG-CDWLRCS MCKTEICWVT 136 XDr|AAH74096.1| CAICFGTIMP-GEGAVLR-ECLHS-FCRDCLKGTVVNCLDA EV CCPYGDNAYACNC XX-YHCKT-PDCAGWCIFE DDVN EFKCDI CNET-NCLLCKAI HKGMN-CKEYQ-XX-MNCPKCQVIVQKK-DG-CDWICCL MCKTEICWVT 136 XDr|XP_698411.1| CRICYVELES-GEGVLLR-ECLHC-FCKECLRSVILMSEDP QV ACPYRDESYACDC XX-YHCAT-ADCPGWCVYE DTVN TFHCPV CKKQ-NCLLCKAI HEGMN-CKQYQ-XX-MHCPQCGIIVQKK-EG-CDWLRCT VCHTEICWVT 136 XHs|NP_112506.1| CPVCYSVLAP-GEAVVLR-ECLHT-FCRECLQGTIRNSQEA EV SCPFIDNTYSCSG XX-YHCKT-PDCKGWCFFE DDVN EFTCPV CFHV-NCLLCKAI HEQMN-CKEYQ-XX-MRCPQCQIVVQKK-DG-CDWIRCT VCHTEICWVT 136 ZDd|XP_641886.1| CSVCADDLDSLNG SYLP-CKHY-SCNDCWNQYLSLKVLE-GGATS ITCMG LKCPSV-XX-RWCPA-PKCGNALKAD-SQTEAT ALCS CGFK-ICFKCKQ ESHFPAD-CEKMK-XX-QDCPKCHSAIEKN-GG-CMHMTCK KCKHEFCWIC 137 ruler 1 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 160 170 structures. The number of exons varies between one (AtARI3) and 15 (AtARI5, AtARI7 and AtARI8). The AtARI genes are differentially expressed during plant development and in an organ-specific manner. Splicing isoforms of RBR proteins are widespread [8-10]. At least for some RBR proteins, alternative splicing leads to shortened isoforms that control the cellular localization and function of a respective parental larger isoform [9]. For the rat transcription factor RBCK1, the RBR domain has a crucial role in its transcriptional activity [11]. RBCK2 has been identified as an alternative splice variant of RBCK1 that lacks the carboxy-terminal part of RBCK1, including the RBR region [11]. Yoshimoto et al. [9] showed that RBCK2 represses the transcriptional activity of RBCK1 by tethering it within the cytoplasm. A similar alternative splice variant lacking the RBR region has been reported recently for parkin [12]. The genetic module coding for the RBR region has apparently been reused in several gene contexts during evolution and has been sequentially modified by point mutations and insertions/deletions and shuffled into new genomic locations. A retrotransposition-based mechanism has been proposed to underlie these changes and evidence hinting at this comes from Arabidopsis [8]. A putative phylogenetic relationship between the RBR segments in various taxonomic ranges is presented in Figure 2, and it is notable that some RBR protein subfamilies are found only in specific taxonomic groups (Additional data file 1); for example, subfamilies C (such as RING finger protein 144), I (IBR domain-containing protein 1, IBRDC1), P (parkin), U (Ariadne-like E3 ubiquitin ligase, PAUL) and X (human hepatitis B virus X-associated protein, XAP) have been found only in animals. Several other subfamilies are specific for fungi (subfamilies E and F) and plants (subfamilies G and H). Besides the large number of RBR protein genes in higher eukaryotes, they also notably occur in unicellular eukaryotes and in entomopoxviruses and iridoviruses [7] (Additional data file 1). Interestingly, there are no genes in archaeal or eubacterial genomes that could truly be called RBR family members. Characteristic structural features The whole RBR segment typically contains some 200 consecutive amino acids. The ring-like sequence domains tend to get smaller going from the amino to the carboxyl terminus - N-RING around 60 residues, IBR around 50 residues, and C-RING around 40 residues [1,2]. Loops on the amino-terminal side of the RBR region have a higher sequence and size variability. In contrast, the cysteine/histidine positions are more strongly conserved in N-RING and the IBR. Substitutions with non-cysteine or non-histidine residues at cysteine/histidine pattern positions are observed only in the C-RING domain, which is known to bind only one zinc ion. Some RBR proteins seem to remain functional without C-RING, but parkin and others apparently require this part of the RBR region for their correct function as E3 ubiquitin ligases [2]. Unfortunately, little direct structural information is available for the RBR region. Capili et al. [3] reported the three-dimensional structure (PDB accession number 1WD2) of the C-RING in the human Ariadne protein HHARI (residues 326-395 of UNIPROT accession number Q9Y4X5, subfamily A1/Ari1), which folds into a novel structure binding a single zinc ion (Figure 3a). Also, a three- dimensional structure (PDB 1WIM, structure report unpub- lished) that essentially represents the N-RING (residues 20-100) in the human UbcM4-interacting protein 4 (subfamily C/RNF144; UNIPROT accession number P50876) is very similar to a classical ring-finger domain (Figure 3b). No structural information is known for any IBR domain. As well as conservation within the RBR segment, the sequence architecture conserved among distant taxa is an important criterion for the classification of RBR proteins, as shown in Figure 4. The functional significance of the additional segments and their cooperation with the RBR part of the sequence is most often not clear, and is certainly an urgent research task for the near future. For example, it would be of interest to determine whether the two hydro- phobic regions in the dorfins (subfamily D), each the length of a transmembrane helix, do function as membrane-attach- ment modules or whether they are critical for protein complex formation. The available data are conflicting. The two long transmembrane helices (each 30-35 residues long with conserved prolines) are predicted by the programs TMHMM [13] and DAS-TMfilter [14,15] at the carboxy- terminal side of the dorfin RBR region. A carboxy-terminal deletion that includes the hydrophobic segment but leaves the RBR region untouched results in an enzyme unable to bind ubiquitinated substrates [16], suggesting that this region is responsible for ubiquitin binding. On the other hand, localization of the protein near the nuclear membrane and the centrosome, co-localization with vimentin, and inter- action with the calcium-sensing receptor CaR (an integral membrane protein) support membrane-embedding [16,17]. RNF144 (subfamily C) and IBRDC1 (subfamily I) also have a predicted transmembrane helix at the carboxy-terminal side of the RBR region, and localization at the Golgi membrane has been shown for RNF144 [18]. The combination of the RBR region with domains and motifs known from the ubiquitination pathway (such as ubiquitin- associated UBA, ubiquitin UBQ, and ubiquitin-interacting motif, UIM) is not a real surprise, whereas the association with helicase domains (DEXDc and HELICc), nucleic-acid- binding domains (KH and RRM) and protein-binding domains (RWD, Armadillo/HEAT repeats and ankyrin segments) would make sense in the context of the involvement of RBR http://genomebiology.com/2007/8/3/209 Genome Biology 2007, Volume 8, Issue 3, Article 209 Eisenhaber et al. 209.3 Genome Biology 2007, 8:209 209.4 Genome Biology 2007, Volume 8, Issue 3, Article 209 Eisenhaber et al. http://genomebiology.com/2007/8/3/209 Genome Biology 2007, 8:209 Figure 2 Phylogenetic tree of RBR domain segments. A grand alignment of RBR segments from 102 proteins representative of the most populated subgroups was used to create the tree. We used the program SEAVIEW and the tool ATV from the Forester package [71-73]. Each entry is labeled as in Figure 1. Typically, subfamily members cluster nicely together and the phylogenetic relationships within subfamilies are determined with significance. Closer to the root of the tree, the branching becomes increasingly uncertain. Some groups of fungal and protozoan sequences are more heterogeneous and appear at several tree positions. The D. discoideum sequence XP_646567.1 does not appear together with other ARA54 sequences but was assigned to the group ‘B (ARA54)’ because of the RWD domain in the sequence architecture. AAt|CAD52897.1| AAt|CAD52895.1| AAt|NP_180709.3| AAt|NP_172080.2| AAt|NP_176722.2| AAt|NP_180737.2| AAt|NP_180735.1| AAt|NP_180736.1| ADd|XP_643727.1| ADd|XP_636442.1| ADd|XP_637482.1| AAt|NP_179206.2| AAt|NP_567966.1| AAt|NP_189408.1| ADm|AAF46823.1| AAm|XP_624643.1| AHs|AAH00422.1| ADr|AAH53248.1| ACe|AAB03121.2| ACe|AAB93644.1| ACe|AAB93643.1| ACe|AAB93645.3| ACe|CAB70234.1| ADm|AAS65398.1| AAm|XP_396912.1| ADr|XP_687241.1| ADr|AAH67684.1| AHs|AAH51877.1| ADm|AAN11912.1| ANc|XP_327168.1| AGz|EAA76603.1| ASp|CAB95997.1| ZDd|XP_641886.1| ZDd|XP_636573.1| PDm|AAN12155.1| PAm|XP_396426.2| PHs|NP_004553.1| PDr|NP_001017635. PCe|CAB04599.2| AHs|NP_055904.1| AHs|AAH63861.1| ADr|XP_689562.1| DDd|XP_645416.1| DDd|XP_637835.1| DHs|NP_904355.1| DDr|XP_690873.1| DDr|CAI21211.1| DAm|XP_623728.1| DCe|AAK68189.1| DDd|XP_629545.1| CDm|AAF58756.2| CAm|XP_393708.2| CHs|AAH50373.1| CDr|CAI20730.1| CDr|AAH76084.1| CHs|NP_877434.2| BCe|AAB52683.1| BAm|XP_624683.1| BHs|NP_899648.1| BDr|NP_001002087. BDr|XP_687162.1| BAt|NP_174512.1| BNc|CAC28847.2| BGz|EAA76614.1| BSp|CAB65614.1| IHs|CAI22999.1| FGz|EAA77042.1| FGz|EAA77041.1| FGz|EAA76086.1| UDm|AAF52435.2| UAm|XP_393719.2| UDr|XP_696033.1| UHs|AAH12077.1| GAt|NP_973536.1| GAt|NP_190140.1| GAt|NP_190144.1| GAt|NP_200833.1| GAt|NP_190133.1| GAt|NP_180108.1| GAt|BAB08302.1| GAt|NP_179737.1| GAt|NP_193702.1| GAt|NP_190937.1| GAt|NP_973485.1| ZDd|XP_635451.1| ZDd|XP_629844.1| ZDd|XP_639066.1| FNc|XP_324871.1| THs|NP_996994.1| TDr|XP_687871.1| VNc|XP_330958.1| VGz|EAA76165.1| WGz|EAA75506.1| BDd|XP_646567.1| HAt|NP_196599.2| HAt|NP_567206.1| ENc|XP_330102.1| EGz|EAA77947.1| XHs|NP_112506.1| XDr|AAH74096.1| XDr|XP_698411.1| XAm|XP_393942.2| http://genomebiology.com/2007/8/3/209 Genome Biology 2007, Volume 8, Issue 3, Article 209 Eisenhaber et al. 209.5 Genome Biology 2007, 8:209 Figure 4 Sequence architecture of RBR proteins. The detailed sequence architecture of the subfamilies of RBR proteins is shown. The globular domains (such as cullin) and non-globular regions (negative-charge clusters or proline-rich regions) are color-coded as shown in the key. It should be noted that the typical sequence architecture is shown. There are several exceptions: for example, PAUL proteins mostly contain three additional zinc fingers, but a few representatives have only one. Similarly, dorfins have two predicted hydrophobic helices with the exception of the protozoan members, which have only one or none. The two sequences of the Fungi1 group are very diverse and have only the RBR segment in common. Among the Plant1 representatives, one protein contains two RRM domains instead of the usual two KH domains. Domain accession numbers: APC10, PF03256; cullin, SM00182; DEXDc, SM00487; IBR, SM00647; RWD, SM00591; DUF1605, PF07717; HA2, PF04408; HELICc, SM00490; KH, SM00322; RRM, SM 00360; ANK, SM002481; UBA, SM00165; UBQ, SM00213; UIM, SM00726; and ZnF_RBZ, SM00547. The first two letters ‘PF’ and ‘SM’ indicate the PFAM and SMART databases, respectively. Group Protein family Domain architecture A0 Ariadne/Ank A1 Ariadne/Ari1 A2 Ariadne/Ari2 A3 Ariadne/PARC A4 Ariadne/fungi A5 Ariadne/plantA A6 Ariadne/plantB A7 Ariadne/plantC A8 Ariadne/prot A9 Ariadne/worms B ARA54 C RNF144 D Dorfin E Fungi1 F Fungi2 G Plant2 H Plant1 I IBRDC1 P Parkin S1 Viruses/Irido S2 Viruses/Pox T1 TRIAD3/animals T2 TRIAD3/fun1 T3 TRIAD3/fun2 U PAU L X XAP3 Z1 Protozoa1 Z2 Protozoa2 500 amino acids APC10 DUF1605 Proline-rich Cullin HA2 UBA DEXDc HELICc UBQ RBR KH Hydrophobic region RBR containing atypical IBR ANK UIM RWD Negative- charge cluster ZnF_RBZ Region with ARM/HEAT-like helical repeats Figure 3 Structures of ring domains in the RBR segments. The structure graphics were generated with the program VMD [74]. The backbone trace and the secondary structure are shown as ribbons and the zinc ions as red spheres. (a) Carboxy-terminal part of the RBR region (C-RING) in the human Ariadne-1 homolog protein HHARI (PDB accession number 1WD2; residues 326-395 of UNIPROT accession number Q9Y4X5; subfamily A1/Ari1). (b) The N-RING of the RBR segment of the human UbcM4-interacting protein 4 (PDB accession number 1WIM; residues 20- 100 of UNIPROT accession number P50876; subfamily C/RNF144). (a) (b) proteins in the regulation of gene expression. A functional link between ubiquitination and RNA metabolism appears to be a general phenomenon [19]. Localization and function RBR proteins fulfill diverse functions, ranging from the control of protein quality to the regulation of translation and signaling [10,20-22]. This diversity is highlighted by the manner in which some RBR proteins were originally dis- covered. Protein-protein interaction studies first attracted attention to the RBR proteins. For example, XAP3 [23] and rat RBCK1 [11] were discovered with the regulatory domain of protein kinase C-β-interacting protein as a bait, and the Ariadne proteins were found as interaction partners of ubiquitin-conjugating enzymes (E2s) in fruit flies, mice and humans [24-27]. The putative Ariadne-like E3 ubiquitin ligase PAUL appeared in a complex extracted with the cytoplasmic domain of the muscle-specific kinase (MuSK) as bait [28]. Parkin is the best characterized RBR protein functionally [29,30]. In a clinical context, mutations in the gene encoding parkin are associated with sporadic early- onset parkinsonism and autosomal recessive juvenile parkinsonism [29-30] and parkin has recently also been associated with susceptibility to intracellular pathogens such as Salmonella typhi, S. paratyphi and Mycobacterium leprae and cancer [31-35]. Several other RBR proteins are involved in human neurodegenerative diseases, susceptibility to infections, and cancer [2, 21,36,37]. E3 ubiquitin ligase activity has been reported for 15 RBR proteins, and 25 of their substrates and more than 70 interactors have been identified so far (Figure 5; Additional data file 1). As typical E3 enzymes, RBR proteins interact with ubiquitin-conjugating enzymes (E2s) and catalyze the covalent attachment of ubiquitin to target proteins [38]. For most of the characterized RBR proteins, the N-RING is essential for recruiting specific E2s and binding substrates. There are exceptions to this rule, however, and substrate interactions have been defined for non-RBR regions as well (Figure 5; Additional data file 1). RBR proteins are considered single-molecule E3 ubiquitin ligases (E3s). However, parkin and the parkin-like cytoplasmic protein (PARC) interact with components of the SCF-like E3 ubiquitin ligase complex, such as cullin and F-box proteins [39,40]. Parkin and dorfin protect dopaminergic neurons from the consequences of mitochondrial damage [41-43] and from harmful levels of aggregation-prone proteins by ubiquitin- mediated proteasomal degradation and/or subcellular tethering of such proteins [29,30,44]. They are also involved in the endoplasmic reticulum-associated degradation pathway (ERAD). This is supported by their interaction with E2s associated with the endoplasmic reticulum and by their role in promoting the degradation of unfolded or misfolded forms of transmembrane proteins, such as the parkin-associated endothelin receptor-like receptor (Pael-R) [45], synaptotagmin XI [46], the AAA- ATPase valosin-containing protein [47], and the dopamine transporter [48], before they accumulate in the endoplasmic reticulum. Moreover, plasma membrane receptors such as the Toll-like receptors TLR4 and TLR9 are substrates for the RBR protein TRIAD3A [10]. This led to the hypothesis that TRIAD3A controls the intensity and duration of pro- inflammatory responses mediated by Toll signaling. A recent study proposes a novel role for parkin in regulating signaling from the epidermal growth factor receptor (EGFR) through its ability to bind EGFR and the EGFR pathway substrate 15 (EPS15) and to ubiquitinate EPS15, consequently regulating the internalization and degradation of EGFR [22]. At least three RBR proteins are involved in the regulation of the cell cycle and apoptosis. PARC acts as negative regulator of the tumor suppressor protein p53. Overexpression of PARC was shown to sequester p53 in the cytoplasm without ubiquitinating it for degradation [49]. In contrast, the RBR protein p53RFP, a member of the RNF144 subfamily (C), targets an inhibitor of cell cycle progression (p21 WAF1 ) for degradation. The zinc finger protein inhibiting NF-κB protein (ZIN), a splicing variant of TRIAD3, similarly supports the degradation of an inhibitor of NF-κB activation (RIP). Overexpression of p53RFP or RIP induces apoptosis [50,51]. The protein Vif, encoded by the human immunodeficiency virus (HIV), induces the translocation of ZIN to the nucleus, suggesting that RBR proteins might be attractive candidates for interfering with virus replication. Vif is important for the assembly of HIV-1 particles and the stability of the reverse transcription complex [37]. Another possible regulator of virus infection is the RBR protein heme-oxidized IRP2 ubiquitin ligase (HOIL-1), which interacts with the X protein of hepatitis B virus and enhances its ability to activate X-responsive promoters [23]. RBR proteins of the Ariadne subfamily are probably involved in translational regulation, as the Ariadne-sub- family protein HHARI ubiquitinates the eukaryotic mRNA cap-binding protein 4EHP [20], which apparently alters the binding efficiency of 4EHP to mRNA caps. 4EHP ubiquitina- tion may also be a signal for the intracellular compart- mentalization of specific mRNA populations. RBR proteins can be recruited by their interaction partners to particular subcellular compartments. For example, RBCK1 is translocated to the nucleus via an interaction with its RBR-domain-deficient splicing variant RBCK2 [9]. Such nucleo-cytoplasmic shuttling is frequent with RBR proteins and is supported by the protein-interaction map of Drosophila [52], which revealed an interaction of the RBR protein ARI-2 with a classical nuclear transport receptor, karyopherin 3. On the other hand, some RBR members may be able to regulate nucleo-cytoplasmic transport themselves. 209.6 Genome Biology 2007, Volume 8, Issue 3, Article 209 Eisenhaber et al. http://genomebiology.com/2007/8/3/209 Genome Biology 2007, 8:209 http://genomebiology.com/2007/8/3/209 Genome Biology 2007, Volume 8, Issue 3, Article 209 Eisenhaber et al. 209.7 Genome Biology 2007, 8:209 Figure 5 Known interactors with the RBR protein. The interacting proteins for each region are boxed and are preceded by the name of the subfamily of RBR proteins with which they interact: A, Ariadne; A3, Parc; B, ARA54; D, dorfin; P, parkin; C, RNF144; X, XAP; U, Paul; T, TRIAD3. The additional amino- terminal domains present in some subfamilies of RBR proteins are highlighted in light blue and indicated by the domain abbreviation with the subfamily in which they are found in parentheses. UBL, ubiquitin-like domain; UBA, ubiquitin-associated domain; ZnF_RBZ, zinc finger; cullin, cullin-like domain; ARM/HEAT, Armadillo and HEAT repeats; APC10, anaphase-promoting complex subunit 10. A carboxy-terminal hydrophobic segment is present in the dorfins. Additional substrates and interactors are listed in Additional data file 1. N-RING C-RING IBR UBL (P) UBA, ZnF_RBZ (U) Cullin, ARM/HEAT, APC10 (A3) 4EHP UBCM4, UBCH7, UBCD10 (UBCH6, UBCH13) p38 Septin4 Synaptotagmin XI CHIP Hsp70 UBCH7, UBCM4 UBCM4 p53 Cul7 O-glyco-α-synuclein IRP2 Rpn10 PRT-2 FLRF/Nrdp1 HRS SUMO-1 SOCS6 A3: P: X: A: P: C: X: B: C: D: P: T: UBE2E2, UBCH6, UBE2E3 UBCH7, UBCH8 UBCH7, UBCH8 VCP Pael-R Septin5 Microtubules RIP Synphilin-1 LRRK2 UBC6, UBC7, UBCH8 P: SIM2 UBC-2, -18,-15 CHN-1 Proteasomal subunit alpha 4 BAG5 P: H CaR Synphilin-1 SOD1 D: U: MuSK A: UBCH7 P: hSel-10 P: 14-3-3 BAG5 Further substrates and interactors SIM2 androgen receptor AR p21 WAF1 DAT cyclin E alpha/beta tubulin Poly Q protein FBP1 RANBP2 Glup/PACRG Vif HIV-1 TLR4, TLR9 hepatitis B virus X protein CBP PML A,P: B: C: P: T: X: P: EPS15 Φ For example, parkin interacts with and ubiquitinates Ran-binding protein 2 (RanBP2), which is related to the small ubiquitin-related modifier (SUMO) E3 ligase family and is a component of the nuclear pore complex [53]. Binding of parkin to SUMO-1 enhances parkin’s nuclear translocation and auto-ubiquitination, indicating that both its E3 activity and subcellular localization are modulated through association with SUMO-1 [54]. Mechanisms of regulation RBR proteins are also subject to posttranslational regulation that predominantly tends to inhibit their E3 activity. Parkin’s stability is controlled by the RING finger domain E3 ligase FLRF/Nrdp1, which interacts with the amino terminus and reduces parkin’s half-life and enzymatic activity [55]. Auto-ubiquitination has been shown to inhibit E3 activity in members of the Ariadne, androgen receptor-associated protein 54 (ARA54), RNF144, dorfin, parkin and TRIAD3 subfamilies [10,16,49,56-62] (Additional data file 1). Parkin’s E3 activity is also suppressed through the binding of the chaperone-like protein 14-3-3η to its linker region (Figure 5). 14-3-3η is released from this inhibitory complex upon its tight binding of α-synuclein. Thus, parkin’s activity is mutually regulated by 14-3-3η and α-synuclein [63]. A comparable antagonistic regulation of parkin by the carboxyl terminus of the Hsc-70-interacting protein (CHIP) and the chaperone Hsp70 is involved in the degradation of unfolded Pael-R [45]. Whereas Hsp70 inhibits parkin’s E3 activity by forming a complex with unfolded Pael-R and parkin, CHIP induces the dissociation of Hsp70 and enhances parkin’s activity and the degradation of Pael-R. Parkin is also inhibited through its enhanced sequestration to protein aggregates on interaction with Bcl-2-associated athanogene 5 (BAG5) and Hsp70 [64]. Phosphorylation is involved in the negative regulation of parkin, as stress-induced reduction of phosphorylation results in an increase in its activity [65]. Parkin is controlled by nitric-oxid (NO) modifications in a biphasic manner [66,67]. Within the first two hours of S-nitrosylation, parkin’s catalytic activity increases. Then it declines gradually and is inhibited 24 hours after NO exposure [68]. Whereas phosphorylation and S-nitrosylation are reversible, a novel irreversible covalent adduct, a dopamine-derived catechol modification of parkin, has been detected that decreases E3 activity and solubility. Parkin is particularly sensitive to this modification, as the adduct could not be transferred to the Ariadne-subfamily member HHARI [69]. Frontiers RBR proteins and their interaction partners appear to be involved in nearly all major cellular events: transcription and RNA metabolism, translation, subcellular tethering, regulation of posttranslational modification and protein stability, cellular and stress signaling, cell-cycle control, and the course of microbial infection. These glimpses into the diverse functions of RBR proteins have mainly been gained by detailed analyses of the multipurpose neuroprotective agent parkin, some ten other animal RBR proteins and a single member in Arabidopsis. Essentially nothing is known about the remaining 350 or so RBR proteins, in particular the animal-specific IBRDC1, and the plant-, fungus-, protozoa- and virus-specific subfamilies (H, G, F, E, Z and S). It is likely that some of these RBR proteins also have E3 activities. It is not yet clear, however, whether RBR proteins act as single molecules and/or in SCF-like E3 ligase complexes, and whether they catalyze mono- or polyubiquitination and lysine 48- or 63-types of linkages. Apart from the E3 ligase function, RBR segments might serve as activation domains, interact with cytoskeletal components, and act as tethering modules. Therefore, one future challenge is to analyze their changing subcellular distributions. Several RBR proteins are associated with neurodegenerative and infectious diseases, and the three-dimensional struc- tures of the IBR and the complete RBR domain, and knowledge of the residues responsible for interactions and structural stabilizations, will be a prerequisite for identifying specific target sites for the possible design of therapeutic drugs. Future work should reveal the functional significance of the additional domains and their cooperation with the RBR domain. This is particularly important for members of the neglected organism-specific subfamilies, as these are found in organisms that pose pathogenic, agricultural and aquacultural threats (for example, the human pathogenic protozoan Entamoeba histolytica and fungus Aspergillus fumigatus, the plant pathogenic fungi Gibberella zeae and Magnaporthe grisea, and the fish and amphibian viruses lymphocystis disease virus and grouper iridovirus). More surprises and astonishing and valuable discoveries are expected from the future analysis of RBR proteins. Additional data file Additional data file 1, containing supplementary tables and additional references, is available online. Acknowledgements BE and FE are grateful to Boehringer Ingelheim for continuous support. This project benefited from a grant to FE under the Gen-AU BIN scheme of the Austrian Federal Ministry of Education, Science and Culture. MTH and NC are supported by the Austrian Science Fund (FWF project P17888) with resources from the Nationalstiftung. References 1. Marin I, Ferrus A: Comparative genomics of the RBR family, including the Parkinson’s disease-related gene parkin and the genes of the Ariadne subfamily. Mol Biol Evol 2002, 19:2039- 2050. 2. Marin I, Lucas JI, Gradilla AC, Ferrus A: Parkin and relatives: the RBR family of ubiquitin ligases. Physiol Genomics 2004, 17:253- 263. 209.8 Genome Biology 2007, Volume 8, Issue 3, Article 209 Eisenhaber et al. http://genomebiology.com/2007/8/3/209 Genome Biology 2007, 8:209 3. Capili AD, Edghill EL, Wu K, Borden KLB: Structure of the C-ter- minal RING finger from a RING-IBR-RING/TRIAD motif reveals a novel zinc-binding domain distinct from a RING. J Mol Biol 2004, 340:1117-1129. 4. Morett E, Bork P: A novel transactivation domain in parkin. Trends Biochem Sci 1999, 24:229-231. 5. van der Reijden BA, Erpelinck-Verschueren CA, Lowenberg B, Jansen JH: TRIADs: a new class of proteins with a novel cysteine- rich signature. Protein Sci 1999, 8:1557-1561. 6. Hulo N, Bairoch A, Bulliard V, Cerutti L, De Castro E, Langendijk- Genevaux PS, Pagni M, Sigrist CJ: The PROSITE database. Nucleic Acids Res 2006, 34:D227-D230. 7. The RBR (ring between ring domains)-type Protein Family [http://mendel.imp.univie.ac.at/SEQUENCES/RBR] 8. Mladek C, Guger K, Hauser MT: Identification and characteriza- tion of the ARIADNE gene family in Arabidopsis. A group of putative E3 ligases. Plant Physiol 2003, 131:27-40. 9. Yoshimoto N, Tatematsu K, Koyanagi T, Okajima T, Tanizawa K, Kuroda S: Cytoplasmic tethering of a RING protein RBCK1 by its splice variant lacking the RING domain. Biochem Biophys Res Commun 2005, 335:550-557. 10. Chuang TH, Ulevitch RJ: Triad3A, an E3 ubiquitin-protein ligase regulating Toll-like receptors. Nat Immunol 2004, 5:495- 502. 11. Tokunaga C, Kuroda S, Tatematsu K, Nakagawa N, Ono Y, Kikkawa U: Molecular cloning and characterization of a novel protein kinase C-interacting protein with structural motifs related to RBCC family proteins. Biochem Biophys Res Commun 1998, 244:353-359. 12. Kitada T, Asakawa S, Minoshima S, Mizuno Y, Shimizu N: Molecular cloning, gene expression, and identification of a splicing variant of the mouse parkin gene. Mamm Genome 2000, 11:417-421. 13. Krogh A, Larsson B, von Heijne G, Sonnhammer EL: Predicting transmembrane protein topology with a hidden Markov model: application to complete genomes. J Mol Biol 2001, 305: 567-580. 14. Cserzo M, Eisenhaber F, Eisenhaber B, Simon I: On filtering false positive transmembrane protein predictions. Protein Eng 2002, 15:745-752. 15. Cserzo M, Eisenhaber F, Eisenhaber B, Simon I: TM or not TM: transmembrane protein prediction with low false positive rate using DAS-TMfilter. Bioinformatics 2004, 20:136-137. 16. Niwa J, Ishigaki S, Doyu M, Suzuki T, Tanaka K, Sobue G: A novel centrosomal RING-finger protein, Dorfin, mediates ubiquitin ligase activity. Biochem Biophys Res Commun 2001, 281:706-713. 17. Huang Y, Niwa J, Sobue G, Breitwieser GE: Calcium-sensing receptor ubiquitination and degradation mediated by the E3 ubiquitin ligase dorfin. J Biol Chem 2006, 281:11610-11617. 18. Hoja MR, Wahlestedt C, Hoog C: A visual intracellular classifi- cation strategy for uncharacterized human proteins. Exp Cell Res 2000, 259:239-246. 19. Lucas JI, Arnau V, Marin I: Comparative genomics and protein domain graph analyses link ubiquitination and RNA metab- olism. J Mol Biol 2006, 357:9-17. 20. Tan NG, Ardley HC, Scott GB, Rose SA, Markham AF, Robinson PA: Human homologue of ariadne promotes the ubiquitylation of translation initiation factor 4E homologous protein, 4EHP. FEBS Lett 2003, 554:501-504. 21. Miyamoto H, Rahman M, Takatera H, Kang HY, Yeh S, Chang HC, Nishimura K, Fujimoto N, Chang C: A dominant-negative mutant of androgen receptor coregulator ARA54 inhibits androgen receptor-mediated prostate cancer growth. J Biol Chem 2002, 277:4609-4617. 22. Fallon L, Belanger CML, Corera AT, Kontogiannea M, Regan-Klapisz E, Moreau F, Voortman J, Haber M, Rouleau G, Thorarinsdottir T, et al.: A regulated interaction with the UIM protein Eps15 implicates parkin in EGF receptor trafficking and PI(3)K- Akt signalling. Nat Cell Biol 2006, 8:834-842. 23. Cong YS, Yao YL, Yang WM, Kuzhandaivelu N, Seto E: The hepati- tis B virus X-associated protein, XAP3, is a protein kinase C-binding protein. J Biol Chem 1997, 272:16482-16489. 24. Martinez-Noel G, Niedenthal R, Tamura T, Harbers K: A family of structurally related RING finger proteins interacts specifi- cally with the ubiquitin-conjugating enzyme UbcM4. FEBS Lett 1999, 454:257-261. 25. Ardley HC, Tan NGS, Rose SA, Markham AF, Robinson PA: Fea- tures of the Parkin/Ariadne-like ubiquitin ligase, HHARI, that regulate its interaction with the ubiquitin-conjugating enzyme, UbcH7. J Biol Chem 2001, 276:19640-19647. 26. Moynihan TP, Ardley HC, Nuber U, Rose SA, Jones PF, Markham AF, Scheffner M, Robinson PA: The ubiquitin-conjugating enzymes UbcH7 and UbcH8 interact with RING finger/IBR motif- containing domains of HHARI and H7-AP1. J Biol Chem 1999, 274:30963-30968. 27. Aguilera M, Oliveros M, Martinez-Padron M, Barbas JA, Ferrus A: Ariadne-1: a vital Drosophila gene is required in develop- ment and defines a new conserved family of RING-finger proteins. Genetics 2000, 155:1231-1244. 28. Bromann PA, Weiner JA, Apel ED, Lewis RM, Sanes JR: A putative ariadne-like E3 ubiquitin ligase (PAUL) that interacts with the muscle-specific kinase (MuSK). Gene Expr Patterns 2004, 4: 77-84. 29. Cookson MR: The biochemistry of Parkinson’s disease. Annu Rev Biochem 2005, 74:29-52. 30. Dawson TM, Dawson VL: Molecular pathways of neurodegen- eration in Parkinson’s disease. Science 2003, 302:819-822. 31. Cesari R, Martin ES, Calin GA, Pentimalli F, Bichi R, McAdams H, Trapasso F, Drusco A, Shimizu M, Masciullo V, et al.: Parkin, a gene implicated in autosomal recessive juvenile parkinsonism, is a candidate tumor suppressor gene on chromosome 6q25- q27. Proc Natl Acad Sci USA 2003, 100:5956-5961. 32. Ali S, Vollaard AM, Widjaja S, Surjadi C, van de Vosse E, van Dissel JT: PARK2/PACRG polymorphisms and susceptibility to typhoid and paratyphoid fever. Clin Exp Immunol 2006, 144:425-431. 33. Mira MT, Alcais A, Van Thuc N, Moraes MO, Di Flumeri C, Hong Thai V, Chi Phuong M, Thu Huong N, Ngoc Ba N, Xuan Khoa P, et al.: Susceptibility to leprosy is associated with PARK2 and PACRG. Nature 2004, 427:636-640. 34. Malhotra D, Darvishi K, Lohra M, Kumar H, Grover C, Sood S, Reddy BSN, Bamezai RNK: Association study of major risk single nucleotide polymorphisms in the common regulatory region of PARK2 and PACRG genes with leprosy in an Indian population. Eur J Hum Genet 2006, 14:438-442. 35. Nikolaev AY, Gu Wei: PARC: a potential target for cancer therapy. Cell Cycle 2003, 2:169-171. 36. Hishikawa N, Niwa Ji, Doyu M, Ito T, Ishigaki S, Hashizume Y, Sobue G: Dorfin localizes to the ubiquitylated inclusions in Parkin- son’s disease, dementia with Lewy bodies, multiple system atrophy, and amyotrophic lateral sclerosis. Am J Pathol 2003, 163:609-619. 37. Feng F, Davis A, Lake JA, Carr J, Xia W, Burrell C, Li P: Ring finger protein ZIN interacts with human immunodeficiency virus type 1 Vif. J Virol 2004, 78:10574-10581. 38. Ardley HC, Robinson PA: E3 ubiquitin ligases. Essays Biochem 2005, 41:15-30. 39. Staropoli JF, McDermott C, Martinat C, Schulman B, Demireva E, Abeliovich A: Parkin is a component of an SCF-like ubiquitin ligase complex and protects postmitotic neurons from kainate excitotoxicity. Neuron 2003, 37:735-749. 40. Skaar JR, Arai T, DeCaprio JA: Dimerization of CUL7 and PARC is not required for all CUL7 functions and mouse development. Mol Cell Biol 2005, 25:5579-5589. 41. Clark IE, Dodson MW, Jiang C, Cao JH, Huh JR, Seol JH, Yoo SJ, Hay BA, Guo M: Drosophila pink1 is required for mitochondrial function and interacts genetically with parkin. Nature 2006, 441:1162-1166. 42. Park J, Lee SB, Lee S, Kim Y, Song S, Kim S, Bae E, Kim J, Shong M, Kim JM, Chung J: Mitochondrial dysfunction in Drosophila PINK1 mutants is complemented by parkin. Nature 2006, 441:1157-1161. 43. Takeuchi H, Niwa Ji, Hishikawa N, Ishigaki S, Tanaka F, Doyu M, Sobue G: Dorfin prevents cell death by reducing mitochondr- ial localizing mutant superoxide dismutase 1 in a neuronal cell model of familial amyotrophic lateral sclerosis. J Neu- rochem 2004, 89:64-72. 44. Cookson MR, Lockhart PJ, McLendon C, O’Farrell C, Schlossmacher M, Farrer MJ: RING finger 1 mutations in parkin produce altered localization of the protein. Hum Mol Genet 2003, 12: 2957-2965. 45. Imai Y, Soda M, Inoue H, Hattori N, Mizuno Y, Takahashi R: An unfolded putative transmembrane polypeptide, which can lead to endoplasmic reticulum stress, is a substrate of parkin. Cell 2001, 105:891-902. http://genomebiology.com/2007/8/3/209 Genome Biology 2007, Volume 8, Issue 3, Article 209 Eisenhaber et al. 209.9 Genome Biology 2007, 8:209 46. Huynh DP, Scoles DR, Nguyen D, Pulst SM: The autosomal reces- sive juvenile Parkinson disease gene product, parkin, inter- acts with and ubiquitinates synaptotagmin XI. Hum Mol Genet 2003, 12:2587-2597. 47. Ishigaki S, Hishikawa N, Niwa Ji, Iemura Si, Natsume T, Hori S, Kak- izuka A, Tanaka K, Sobue G: Physical and functional interaction between Dorfin and Valosin-containing protein that are colocalized in ubiquitylated inclusions in neurodegenerative disorders. J Biol Chem 2004, 279:51376-51385. 48. Jiang H, Jiang Q, Feng J: Parkin increases dopamine uptake by enhancing the cell surface expression of dopamine trans- porter. J Biol Chem 2004, 279:54380-54386. 49. Nikolaev AY, Li M, Puskas N, Qin J, Gu W: Parc: A cytoplasmic anchor for p53. Cell 2003, 112:29-40. 50. Chen D, Li X, Zhai Z, Shu HB: A novel zinc finger protein inter- acts with receptor-interacting protein (RIP) and inhibits tumor necrosis factor (TNF)- and IL1-induced NF-kappa B activation. J Biol Chem 2002, 277:15985-15991. 51. Huang J, Xu LG, Liu T, Zhai Z, Shu HB: The p53-inducible E3 ubiquitin ligase p53RFP induces p53-dependent apoptosis. FEBS Lett 2006, 580:940-947. 52. Giot L, Bader JS, Brouwer C, Chaudhuri A, Kuang B, Li Y, Hao YL, Ooi CE, Godwin B, Vitols E, et al.: A protein interaction map of Drosophila melanogaster. Science 2003, 302:1727-1736. 53. Um JW, Min DS, Rhim H, Kim J, Paik SR, Chung KC: Parkin ubiqui- tinates and promotes the degradation of RanBP2. J Biol Chem 2006, 281:3595-3603. 54. Um JW, Chung KC: Functional modulation of parkin through physical interaction with SUMO-1. J Neurosci Res 2006, 84: 1543-1554. 55. Zhong L, Tan Y, Zhou A, Yu Q, Zhou J: RING finger ubiquitin- protein isopeptide ligase Nrdp1/FLRF regulates Parkin sta- bility and activity. J Biol Chem 2005, 280:9425-9430. 56. Tan NGS, Ardley HC, Rose SA, Leek JP, Markham AF, Robinson PA: Characterisation of the human and mouse orthologues of the Drosophila ariadne gene. Cytogenet Cell Genet 2000, 90:242- 245. 57. Springer W, Hoppe T, Schmidt E, Baumeister R: A Caenorhabditis elegans Parkin mutant with altered solubility couples alpha- synuclein aggregation to proteotoxic stress. Hum Mol Genet 2005, 14:3407-3423. 58. Kang HY, Yeh S, Fujimoto N, Chang C: Cloning and characteri- zation of human prostate coactivator ARA54, a novel protein that associates with the androgen receptor. J Biol Chem 1999, 274:8570-8576. 59. Marteijn JA, van Emst L, Erpelinck-Verschueren CA, Nikoloski G, Menke A, de Witte T, Lowenberg B, Jansen JH, van der Reijden BA: The E3 ubiquitin-protein ligase Triad1 inhibits clonogenic growth of primary myeloid progenitor cells. Blood 2005, 106: 4114-4123. 60. Ng CC, Arakawa H, Fukuda S, Kondoh H, Nakamura Y: p53RFP, a p53-inducible RING-finger protein, regulates the stability of p21WAF1. Oncogene 2003, 22:4449-4458. 61. Zhang Y, Gao J, Chung KKK, Huang H, Dawson VL, Dawson TM: Parkin functions as an E2-dependent ubiquitin-protein ligase and promotes the degradation of the synaptic vesicle-asso- ciated protein, CDCrel-1. Proc Natl Acad Sci USA 2000, 97:13354- 13359. 62. Ito K, Adachi S, Iwakami R, Yasuda H, Muto Y, Seki N, Okano Y: N- terminally extended human ubiquitin-conjugating enzymes (E2s) mediate the ubiquitination of RING-finger proteins, ARA54 and RNF8. Eur J Biochem 2001, 268:2725-2732. 63. Sato S, Chiba T, Sakata E, Kato K, Mizuno Y, Hattori N, Tanaka K: 14-3-3eta is a novel regulator of parkin ubiquitin ligase. EMBO J 2006, 25:211-221. 64. Kalia SK, Lee S, Smith PD, Liu L, Crocker SJ, Thorarinsdottir TE, Glover JR, Fon EA, Park DS, Lozano AM: BAG5 unhibits parkin and enhances dopaminergic neuron degeneration. Neuron 2004, 44:931-945. 65. Yamamoto A, Friedlein A, Imai Y, Takahashi R, Kahle PJ, Haass C: Parkin phosphorylation and modulation of its E3 ubiquitin ligase activity. J Biol Chem 2005, 280:3390-3399. 66. Yao D, Gu Z, Nakamura T, Shi ZQ, Ma Y, Gaston B, Palmer LA, Rockenstein EM, Zhang Z, Masliah E, et al.: Nitrosative stress linked to sporadic Parkinson’s disease: S-nitrosylation of parkin regulates its E3 ubiquitin ligase activity. Proc Natl Acad Sci USA 2004, 101:10810-10814. 67. Chung KK, Dawson VL, Dawson TM: S-nitrosylation in Parkin- son’s disease and related neurodegenerative disorders. Methods Enzymol 2005, 396:139-150. 68. Stuart AL, Tomohiro N, Dongdong S, Takashi U, Zezong G: Comment on “S-nitrosylation of parkin regulates ubiquiti- nation and compromises parkin’s protective function”. Science 2005, 308:1870. 69. LaVoie MJ, Ostaszewski BL, Weihofen A, Schlossmacher MG, Selkoe DJ: Dopamine covalently modifies and functionally inacti- vates parkin. Nat Med 2005, 11:1214-1221. 70. Chenna R, Sugawara H, Koike T, Lopez R, Gibson TJ, Higgins DG, Thompson JD: Multiple sequence alignment with the clustal series of programs. Nucleic Acids Res 2003, 31:3497-3500. 71. Zmasek CM, Eddy SR: A simple algorithm to infer gene dupli- cation and speciation events on a gene tree. Bioinformatics 2001, 17:821-828. 72. Zmasek CM, Eddy SR: ATV: display and manipulation of anno- tated phylogenetic trees. Bioinformatics 2001, 17:383-384. 73. Galtier N, Gouy M, Gautier C: SEAVIEW and PHYLO_WIN: two graphic tools for sequence alignment and molecular phylogeny. Comput Appl Biosci 1996, 12:543-548. 74. Humphrey W, Dalke A, Schulten K: VMD: Visual molecular dynamics. J Mol Graph 1996, 14:33-38. 209.10 Genome Biology 2007, Volume 8, Issue 3, Article 209 Eisenhaber et al. http://genomebiology.com/2007/8/3/209 Genome Biology 2007, 8:209 . Marie-Theres.Hauser@boku.ac.at Summary Proteins of the ring between ring fingers (RBR)- domain family are characterized by three groups of specifically clustered (typically eight) cysteine and histidine residues Genome Biology 2007, 8:209 Protein family review The ring between ring fingers (RBR) protein family Birgit Eisenhaber*, Nina Chumak † , Frank Eisenhaber*. http://genomebiology.com/2007/8/3/209 © 2007 BioMed Central Ltd Gene organization and evolutionary history The ring between ring fingers (RBR) proteins are a large and diverse group of proteins characterized