báo cáo khoa học: " A pilot histomorphology and hemodynamic of vasculogenic mimicry in gallbladder carcinomas in vivo and in vitro" pptx

báo cáo khoa học: " A pilot histomorphology and hemodynamic of vasculogenic mimicry in gallbladder carcinomas in vivo and in vitro" pptx

báo cáo khoa học: " A pilot histomorphology and hemodynamic of vasculogenic mimicry in gallbladder carcinomas in vivo and in vitro" pptx

... this article as: Sun et al.: A pilot histomorphology and hemodynamic of vasculogenic mimicry in gallbladder carcinomas in vivo and in vitro. Journal of Experimental & Clinical Cancer Research ... reported VM in human gallbladder carcinomas and its clinical significance. In this study, we further studied histomorphology and hemodynamic of V...
Ngày tải lên : 10/08/2014, 10:21
  • 12
  • 273
  • 0
Báo cáo khoa học: A strategy for the generation of specific human antibodies by directed evolution and phage display An example of a single-chain antibody fragment that neutralizes a major component of scorpion venom docx

Báo cáo khoa học: A strategy for the generation of specific human antibodies by directed evolution and phage display An example of a single-chain antibody fragment that neutralizes a major component of scorpion venom docx

... CCACCAGAACCTCCGCCTCCTGATCCGCCACCTCCTGAGGAGACGGTGACCAGGGTGCC JH3.link CCACCAGAACCTCCGCCTCCTGATCCGCCACCTCCTGAAGAGACGGTGACCATTGTCCC JH4-5.link CCACCAGAACCTCCGCCTCCTGATCCGCCACCTCCTGAGGAGACGGTGACCAGGGTTCC JH6.link CCACCAGAACCTCCGCCTCCTGATCCGCCACCTCCTGAGGAGACGGTGACCGTGGTCCC L. ... orientation. VK1.link GGCGGATCAGGAGGCGGAGGTTCTGGTGGAGGTGGGAGTGACATCCAGATGACCCAGTCTCC VK2.link GGCGGATCAGGAGGCGGAGGTTCTG...
Ngày tải lên : 23/03/2014, 13:20
  • 11
  • 679
  • 0
Tài liệu Báo cáo khoa học: "A High-Accurate Chinese-English NE Backward Translation System Combining Both Lexical Information and Web Statistics" pdf

Tài liệu Báo cáo khoa học: "A High-Accurate Chinese-English NE Backward Translation System Combining Both Lexical Information and Web Statistics" pdf

... combining both linguistic and statistical information to find the correct transla- tion. Our system can be split into three steps: candidate retrieving, candidate evaluating, and candidate ... Abstract Named entity translation is indispensable in cross language information retrieval nowadays. We propose an approach of combining lexical information, web sta- tistics, and inv...
Ngày tải lên : 20/02/2014, 12:20
  • 8
  • 569
  • 0
Báo cáo khoa học: "A Pilot Study of Opinion Summarization in Conversations" docx

Báo cáo khoa học: "A Pilot Study of Opinion Summarization in Conversations" docx

... contains opinion. To obtain this, we trained a maximum entropy classifier with a bag -of- words model using a combination of data sets from several domains, including movie data (Pang and Lee, 2004), ... Philadelphia. Andrew Hayes and Klaus Krippendorff. 2007. Answer- ing the call for a standard reliability measure for cod- ing data. Journal of Communication Methods and Measu...
Ngày tải lên : 17/03/2014, 00:20
  • 9
  • 442
  • 0
Báo cáo khoa học: A hydrophilic cation-binding protein of Arabidopsis thaliana, AtPCaP1, is localized to plasma membrane via N-myristoylation and interacts with calmodulin and the phosphatidylinositol phosphates PtdIns(3,4,5)P3 and PtdIns(3,5)P2 pptx

Báo cáo khoa học: A hydrophilic cation-binding protein of Arabidopsis thaliana, AtPCaP1, is localized to plasma membrane via N-myristoylation and interacts with calmodulin and the phosphatidylinositol phosphates PtdIns(3,4,5)P3 and PtdIns(3,5)P2 pptx

... detection of PCaP1 orthologous protein in crude membrane fractions with anti-PCaP1. Lanes 1 and 6, A. thaliana; lanes 2 and 7, Raphanus sativus; lanes 3 and 8, Brassica rapa; lanes 4 and 9, B. rapa var. ... recombinant PCaP1 as the standard protein. As shown in Fig. 2A, a highly purified preparation of PCaP1 without any tag was obtained. The protein was analysed by SDS-PAGE...
Ngày tải lên : 23/03/2014, 07:20
  • 16
  • 424
  • 0
Báo cáo khoa học: "A step towards the detection of semantic variants of terms in technical documents Thierry Hamon and Adeline " potx

Báo cáo khoa học: "A step towards the detection of semantic variants of terms in technical documents Thierry Hamon and Adeline " potx

... height) panneau de commande (control panel) d~gradation importante (important damage) mauvaise manipulation (bad handling) intervention de l'op6rateur (intervention of the operator) volume ... Using an automatic clustering method based on noun-modifier relationship. In Proceedings of ACL'97- Student Session, Madrid, Spain. Roberto Basili, Maria Teresa Pazienza, and...
Ngày tải lên : 23/03/2014, 19:20
  • 7
  • 522
  • 0
Báo cáo khoa học: A novel glycogen-targeting subunit of protein phosphatase 1 that is regulated by insulin and shows differential tissue distribution in humans and rodents pdf

Báo cáo khoa học: A novel glycogen-targeting subunit of protein phosphatase 1 that is regulated by insulin and shows differential tissue distribution in humans and rodents pdf

... RGRRARSAPAGGGGARAPRSRSPDTRKRVRFADALGLELAVVRRFRPGELPRVPRHVQI MOUSE R3E 119 QLQRDALRHFAPCPPRARGLQEARVALEPALEPGFAARLQAQRICLERADAGPLGVAGS RAT R3E 119 QLQRDALRHFAPCPPRTRGLQDARIALEPALEPGFAARLQAQRICLERADAGPLGVAGS HUMAN ... ARVLDLAYEKRVSVRWSADGWRSLRESPASYAGPAPAPPRADRFAFRLPAPPVGGALLF HUMAN R3E 178 ARVVDLAYEKRVSVRWSADGWRSQREAPAAYAGPAPPPPRADRFAFRLPAPPIGGALLF MOUSE R3E 237 ALRYRVTGREFWDNNGGRDYALLGPEHPAGA...
Ngày tải lên : 30/03/2014, 16:20
  • 12
  • 381
  • 0
Báo cáo khoa học: "A Pilot Study of Implicit Attitude using Latent Textual Semantics" pdf

Báo cáo khoa học: "A Pilot Study of Implicit Attitude using Latent Textual Semantics" pdf

... classification and analysis of multivariate observations. In Proceedings of Fifth Berkeley Symposium on Mathematical Statis- tics and Probability. Christopher D. Manning, Prabhakar Raghavan, , and ... and aspect -of re- lations in opinion mining. In Proceedings of the 2007 Joint Conference on Empirical Methods in Natu- ral Language Processing and Computational Natural...
Ngày tải lên : 30/03/2014, 17:20
  • 5
  • 364
  • 0
Báo cáo khoa học: "A Competition-Ba sed Explanation of Syntactic Attachment Preferences and Garden Path Phenomena" pot

Báo cáo khoa học: "A Competition-Ba sed Explanation of Syntactic Attachment Preferences and Garden Path Phenomena" pot

... originally attached does not have an alternative a- node to activate, re- analysis cannot take place and a garden path results. The allowable attachment configurations are a direct consequence of ... activate instead of its required two attachments. CAPERS again settles on an ungram- matical analysis in which the current clause has an 271 Figure 4: Example pairs of inco...
Ngày tải lên : 31/03/2014, 06:20
  • 8
  • 503
  • 0
Báo cáo khoa học: "A colliding maxillary sinus cancer of adenosquamous carcinoma and small cell neuroendocrine carcinoma - a case report with EGFR copy number analysis" pot

Báo cáo khoa học: "A colliding maxillary sinus cancer of adenosquamous carcinoma and small cell neuroendocrine carcinoma - a case report with EGFR copy number analysis" pot

... rapidly and the patient expired at 8 months after surgery. Conclusion: A colliding tumor of squamous cell, adenocarcinoma and neuroendocrine carcinoma in maxillary sinus was aggressive in behavior ... Avitia S, Osborne RF: Blindness: a sequela of sinonasal small cell neuroendocrine carcinoma. Ear Nose Throat J 2004, 83:530-532. 14. Alos L, Castillo M, Nadal A, Caballero M, Ma...
Ngày tải lên : 09/08/2014, 03:22
  • 5
  • 342
  • 0

Xem thêm

Từ khóa: