Báo cáo khoa học: "Ectomycorrhization of Acacia holosericea

Báo cáo khoa học: "Ectomycorrhization of Acacia holosericea A. Cunn. ex G. Don by Pisolithus spp. in Senegal: Effect on plant growth and on the root-knot nematode Meloidogyne javanica Robin Duponnois" potx

... Springfield (1962) pp. 329. Original article Ectomycorrhization of Acacia holosericea A. Cunn. ex G. Don by Pisolithus spp. in Senegal: Effect on plant growth and on the root-knot nematode Meloidogyne ... of Acacia holosericea with fungi isolated in Senegal (belonging to the Pisolithus genus) and their effect on Meloidogyne javan...

Ngày tải lên : 08/08/2014, 14:22

6
348
0

Báo cáo khao học: "Influence of the dual arbuscular endomycorrhizal / ectomycorrhizal symbiosis on the growth of Acacia holosericea (A. Cunn. ex G. Don) in glasshouse conditions" pptx

... together. For example, the Kcon- centrations in the leaves of inoculated plants with G. aggregatum alone were higher than that of co-inoculated plants. K plays a major role in plant water relations ... M., Ectomycorrhization of Aca- cia holosericea A. Cunn. ex G. Don by Pisolithus spp. in Sene- gal: Effect on plant growth and on the root-knot...

Ngày tải lên : 08/08/2014, 14:20

6
448
0

Tài liệu Báo cáo khoa học: Kinetics of dextran-independent a-(1 ﬁ 3)-glucan synthesis by Streptococcus sobrinus glucosyltransferase I pdf

... an artificial reaction catalyzed by the deficient protein, but rather a basal reaction of GTF-I. In contrast, in the presence of dextran, the enzymatic activity of GSGB was much higher than that ... glucan-binding domain-deficient glucosyltransferase-I; GSd, glucansucrase domain; GSGB, glucosyltransferase-I containing a full-length glucan-binding domain; GTF, glucosyltransf...

Ngày tải lên : 14/02/2014, 22:20

10
661
0

Báo cáo khoa học: ` Inhibition of human ether a go-go potassium channels by 2+ Ca ⁄calmodulin binding to the cytosolic N- and C-termini potx

... be reconstituted by administration of recombinant CaM. Assaying CaM binding to GST-fusion proteins of the C-terminal domain of hEAG1 channels, a binding site was locali- zed within amino-acids ... by increasing the intracellular Ca 2+ concentration leads to exposure of regions in the CaM ⁄ SK2 complex that induce an interaction between neighboring SK2-CaM binding domains...

Ngày tải lên : 07/03/2014, 12:20

13
500
0

Tài liệu Báo cáo khoa học: Synchronization of Ca2+ oscillations: a coupled oscillator-based mechanism in smooth muscle ppt

... Pharmacology, University of Calgary, Alberta, Canada 2 School of Biomedical Sciences, University of Newcastle, Callaghan, NSW, Australia Long-range signaling Biological organs display coordinated ... Vinogradova T, Lyashkov A, Sirenko S, Zhu W, Ruknudin A & Maltsev VA (2006) The integra- tion of spontaneous intracellular Ca2+ cycling and surface membrane ion channel activat...

Ngày tải lên : 16/02/2014, 09:20

8
709
0

Tài liệu Báo cáo khoa học: Synchronization of Ca2+ oscillations: a capacitative (AC) electrical coupling model in neuroepithelium pptx

... channels are activated by a positive voltage change on the luminal side and by an increase in the luminal [Ca 2+ ] [4,7]. Because the clos- ing of the store BK channels attenuates Ca 2+ release [4], ... capaci- tance of the ONM and the plasma membrane as capacitative currents (I C in Fig. 1D). The AC could synchronize the voltage ﬂuctuations of the Ca...

Ngày tải lên : 16/02/2014, 09:20

7
641
0

Tài liệu Báo cáo khoa học: Proteolysis of Pseudomonas exotoxin A within hepatic endosomes by cathepsins B and D produces fragments displaying in vitro ADP-ribosylating and apoptotic effects doc

... (h) AEEAFDLWNECAKACVLDLKDGVRSSRMSVDPAIADTNGQGVLHYSMVLEGGNDALKLAIDN ALSITSDGLTIRLEGGVEPNKPVRYSYTRQARGSWSLNWLVPIGHEKPSNIKVFIHELNAGN QLSHMSPIYTIEMGDELLAKLARDATFFVRAHESNEMQPTLAISHAGVSVVMAQTQPRREKR WSEWASGKVLCLLDPLDGVYNYLAQQRCNLDDTWEGKIYRVLAGNPAKHDLDIKPTVISHRL HFPEGGSLAALTAHQACHLPLETFTRHRQPR 279 1 ETA-B 280 GWEQLEQCGYPVQRLVALYLAARLSWNQVDQ V IRNALASPGSGGDLGEAIREQPEQARLALTLAAAESERFVRQGTGNDEAGAANADVV...

Ngày tải lên : 18/02/2014, 04:20

15
588
0

Tài liệu Báo cáo khoa học: Dissociation of DNA polymerase a-primase complex during meiosis in Coprinus cinereus pptx

... centrifugation and the pellet was resuspended in 20 mL of TEMG buffer containing 300 m M NaCl and dialyzed against TEMG buffer containing 300 m M NaCl. This fraction was passed through a DEAE–Sepharose ... double-strand breaks (DSBs) followed by formation of single-stranded DNA by exonuclease digestion. The single-strand portion invades the regions having homologous se...

Ngày tải lên : 20/02/2014, 11:20

10
476
0

Tài liệu Báo cáo khoa học: Cleavage of nonphenolic b-1 diarylpropane lignin model dimers by manganese peroxidase from Phanerochaete chrysosporium Evidence for a hydrogen abstraction mechanism docx

... owing to the lack of an electron-donating methoxy group at the para position of the A ring. This strongly suggests that a cation radical is difﬁcult to produce with this substrate. In contrast, in ... LiP oxidation of the diarylpropane I proceeds by the formation of an aryl cation radical [16], these results suggest that a cation radical is not an intermediate i...

Ngày tải lên : 20/02/2014, 23:20

9
496
1

Báo cáo khoa học: Modulation of nitric oxide-mediated metal release from metallothionein by the redox state of glutathione in vitro doc

... published demonstrating the physiological signiﬁcance of the NO–MT interaction and in particular the metal release in vivo.Using a ﬂuorescent MT2 fusion protein, a conformational change in MT2, indicative ... in the MT2 fraction, taking into consideration the dilution effects by adding stock solutions of GSH, GSSG and DEA/NO (Fig. 2) clearly show that the rel...

Ngày tải lên : 07/03/2014, 15:20

9
398
0

Báo cáo khoa học: "Ectomycorrhization of Acacia holosericea A Cunn ex G Don by Pisolithus spp in Senegal: Effect on plant growth and on the root-knot nematode Meloidogyne javanica Robin Duponnois" potx