Tài liệu Báo cáo Y học: Inhibition of the MEK/ERK signaling pathway by the novel antimetastatic agent NAMI-A down regulates c-myc gene expression and endothelial cell proliferation ppt
Tài liệu Báo cáo khoa học: Inhibition of cobalamin-dependent methionine synthase by substituted benzo-fused heterocycles pptx
... the production of
methionine and S-AdoMet [6,7]. Furthermore, MetS is
the only human enzyme that metabolizes methyltetra-
hydrofolate to tetrahydrofolate, thereby facilitating the
recycling of ... a cofactor [1]. MetS catalyses the transfer
of the methyl group from 5-methyltetrahydrofolate to
homocysteine via the CH
3
-Cbl cofactor, with cycling
of cobalamin between the...
Tài liệu Báo cáo khoa học: Inhibition of pneumococcal choline-binding proteins and cell growth by esters of bicyclic amines pptx
... in the separ-
ation of the daughter cells at the end of cell division
and in cellular autolysis [9], where it mediates the
release of toxins that damage the host tissues and
allows the entry of ... the structures of both
the ligated and unligated forms of C-LytA, due to the
insolubility of the protein at the required concentra-
tions. The recently...
Tài liệu Báo cáo khoa học: Inhibition of pea ferredoxin–NADP(H) reductase by Zn-ferrocyanide docx
... [51,52].
The O of Ser90 and the S of Cys266 of pea FNR are close
to N5 and O4 of the isoalloxazine, which are involved in
hydride transfer. The hydroxy group of Ser90 could accept a
hydrogen bond and ... presence of the inhibitor, and disrupting the electron
transfer between the flavin and the second substrate mainly
causes enzyme inhibition by Zn-ferr...
Tài liệu Báo cáo khoa học: Modulation of F0F1-ATP synthase activity by cyclophilin D regulates matrix adenine nucleotide levels pptx
... of CYPD
or its inhibition by cyclosporin A significantly
enhanced the rate of F
0
F
1
-ATP synthase-mediated
regeneration of ATP consumed by arsenolysis in the
matrix and decreased the extent of ... ablation of the ppif gene or inhibi-
tion of CYPD binding on F
0
F
1
-ATP synthase by
cyclosporin A led to a disinhibition of the ATPase,
resulting in accelerate...
Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc
... DFQPP-YFPPPY QPLPYHQSQDP YSHVN-DPYS LNPLHQ-PQ Q
Gamma GVA EYQPPPYFPPPY QQLAYSQSADP YSHLG-EAYAAAINPLHQPAPTGSQ
Epsilon PAATAAAEFQPP-YFPPPYPQPPLPYGQAPDAAAAFPHLAGDPYGG-LAPLAQPQPP
Delta TTG TEFASP-YFSTNHQYTPL-HHQSFHYEFQHSHPAVTPDAYSLNSLHHSQQYYQQ ... of the AP-2 structure.
Expression patterns of AP-2 molecules
and functional implications
The expression and function of AP-2 isofo...
Tài liệu Báo cáo khoa học: ¨ Induction of Kruppel-like factor 4 by high-density lipoproteins promotes the expression of scavenger receptor class B type I pptx
... THP-1 cells, and the subsequent
expressions of SR-BI were analysed by real-time PCR and western blot.
The binding and transcriptional activities of KLF4 to the SR-BI promoter
were detected by electrophoretic ... to
synthesize the complimentary cDNA using the First Strand
Synthesis Kit (Invitrogen). The cDNA from this synthesis
was then used in quantitative real-time...
Tài liệu Báo cáo khoa học: Glycation of low-density lipoprotein results in the time-dependent accumulation of cholesteryl esters and apolipoprotein B-100 protein in primary human monocyte-derived macrophages docx
... methylglyoxal and 3-deoxygluco-
sone in the glycation of proteins by glucose. Biochem J
344, 109–116.
23 Atkins TW & Thornalley PJ (1989) Erythrocyte gly-
oxalase activity in genetically obese ... Group, The Heart Research Institute, Camperdown, Sydney, NSW, Australia
2 Department of Health Sciences, University of Technology Sydney, NSW, Australia
3 Faculty of Medicine, Un...
Tài liệu Báo cáo khoa học: Delineation of exoenzyme S residues that mediate the interaction with 14-3-3 and its biological activity ppt
... ADP-ribosylation of Ras
requires the Leu-428 residue
Ras is modified by the ADP-ribosylating activity of
ExoS expressed and delivered into the eukaryotic cells
by genetically modified Y. pseudotuberculosis ... fact that before the
ADP-ribosylation activity of translocated ExoS causes
cell death, the infected cells undergo a morphology
change whereby they round up due to...
Tài liệu Báo cáo khóa học: Inactivation of copper-containing amine oxidases by turnover products doc
... from the 350 nm band formed by
Co- and Ni-AGAO, the LCAO band was not affected by
the admission of oxygen in solution. Thus, the inactivated
protein was unable to hydrolyze the aldehyde and to ... inactivated,
slowly formed a band at 420 nm, typical of the 2-hydraz-
inopyridine adduct of TPQ. The final band intensity
matched the residual activity of the soluti...
Tài liệu Báo cáo khoa học: Binding of ligands originates small perturbations on the microscopic thermodynamic properties of a multicentre redox protein pptx
... essentially unaffected. Although neither of the lig-
ands tested is a physiological partner of cytochrome c
3
, the small changes
observed for the thermodynamic properties of cytochrome c
3
bound to
these ... essentially
undisturbed by the replacement of Fe by Zn in the
rubredoxin given the identical structures of the two
protein forms [38,39]. Therefore, at the...
Từ khóa:
- tài liệu báo cáo khoa học bản chất của khủng hoảng kinh tế thế giới pdf
- tài liệu báo cáo nghiên cứu khoa học
- tai lieu bao cao thuc tap y si da khoa
- tai lieu bao cao thuc tap tim hieu nhan cach mot hoc sinh
- nghiên cứu các tài liệu báo cáo của các nhà nghiên cứu đi trước về các lập luận khoa học về trồng và phòng bệnh dịch cho hoa hồng cách quản lý sử dụng phân bón đúng cách vv
- báo cáo y học
- tài liệu báo cáo
- tài liệu báo cáo môn triết
- tài liệu báo cáo tài chính
- tài liệu di truyền y học
- tài liệu báo cáo môn
- báo cáo y học
- tài liệu báo cáo tài chính vốn bằng tiền tai doanh nghiệp
- tài liệu vi sinh y học
- tài liệu báo cáo môn triếtquan hệ sản xuất
- Báo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018
- Báo cáo quy trình mua hàng CT CP Công Nghệ NPV
- chuyên đề điện xoay chiều theo dạng
- Một số giải pháp nâng cao chất lượng streaming thích ứng video trên nền giao thức HTTP
- Nghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt nam
- Biện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọ
- Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit
- Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit
- ĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN
- Phát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninh
- Trả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)
- Phát hiện xâm nhập dựa trên thuật toán k means
- Nghiên cứu, xây dựng phần mềm smartscan và ứng dụng trong bảo vệ mạng máy tính chuyên dùng
- Nghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chế
- Định tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)
- Tìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tin
- Thơ nôm tứ tuyệt trào phúng hồ xuân hương
- Chuong 2 nhận dạng rui ro
- Tranh tụng tại phiên tòa hình sự sơ thẩm theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn xét xử của các Tòa án quân sự Quân khu (Luận văn thạc sĩ)
- Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật