Phân tích hệ gen biểu hiện (exome) ở con của nạn nhân chất độc da cam dioxin bị thiểu năng trí tuệ

68 1 0
  • Loading ...
1/68 trang

Thông tin tài liệu

Ngày đăng: 07/05/2020, 23:24

BỘ GIÁO DỤC VÀ ĐÀO TẠO VIỆN ĐẠI HỌC MỞ HÀ NỘI LUẬN VĂN THẠC SỸ CHUYÊN NGÀNH: CÔNG NGHỆ SINH HỌC PHÂN TÍCH HỆ GEN BIỂU HIỆN (EXOME) Ở CON CỦA NẠN NHÂN CHẤT ĐỘC DA CAM/DIOXIN BỊ THIỂU NĂNG TRÍ TUỆ NGUYỄN THỊ HIỀN HÀ NỘI, 2017 BỘ GIÁO DỤC VÀ ĐÀO TẠO VIỆN ĐẠI HỌC MỞ HÀ NỘI LUẬN VĂN THẠC SĨ PHÂN TÍCH HỆ GEN BIỂU HIỆN (EXOME) Ở CON CỦA NẠN NHÂN CHẤT ĐỘC DA CAM/DIOXIN BỊ THIỂU NĂNG TRÍ TUỆ NGUYỄN THỊ HIỀN CHUYÊN NGÀNH : CÔNG NGHỆ SINH HỌC MÃ SỐ : 8420201 NGƯỜI HƯỚNG DẪN KHOA HỌC: PGS.TS NGUYỄN HUY HOÀNG HÀ NỘI, 12/2017 LỜI CAM ĐOAN Tôi xin cam đoan, cơng trình nghiên cứu khoa học riêng tơi hướng dẫn PGS.TS Nguyễn Huy Hoàng Các số liệu, kết luận văn trung thực chưa cơng bố cơng trình khác Học viên Nguyễn Thị Hiền LỜI CẢM ƠN Để hồn thành đề tài luận văn thạc sĩ cách hoàn chỉnh, bên cạnh nỗ lực cố gắng thân có hướng dẫn nhiệt tình q Thầy Cơ, động viên ủng hộ gia đình bạn bè suốt thời gian học tập nghiên cứu thực luận văn thạc sĩ Xin chân thành bày tỏ lòng biết ơn đến PGS.TS Nguyễn Huy Hồng người hết lòng giúp đỡ tạo điều kiện tốt cho tơi hồn thành luận văn Xin chân thành bày tỏ lòng biết ơn đến tồn thể quý thầy cô Khoa đào tạo sau Đại học – Viện Đại học Mở Hà Nội tận tình truyền đạt kiến thức quý báu tạo điều kiện thuận lợi cho suốt trình học tập nghiên cứu thực đề tài luận văn Xin chân thành bày tỏ lòng biết ơn đến Viện nghiên cứu hệ gen – Viện Hàn lâm Khoa học Công nghệ Việt Nam không ngừng hỗ trợ tạo điều kiện tốt cho suốt thời gian nghiên cứu thực luận văn Cuối cùng, xin chân thành cảm ơn đến gia đình, anh chị bạn đồng nghiệp hỗ trợ cho nhiều suốt trình học tập, nghiên cứu thực đề tài luận văn thạc sĩ cách hoàn chỉnh Hà Nội, tháng 10 năm 2017 Học viên thực Nguyễn Thị Hiền DANH MỤC CÁC KÍ HIỆU, CÁC CHỮ VIẾT TẮT - CĐDC: Chất độc da cam - CĐHH: Chất độc hóa học - cDNA: Complementary DNA – ADN bổ trợ - DTBS: Dị tật bẩm sinh - GATK: Genome Analysis Toolkit – Công cụ phân tích hệ gen - ID: Intellectual disability – Khuyết tật trí tuệ - IQ: intelligence quotient – Chỉ số thơng minh - HET: Heterozygote – Biến thể dị hợp tử - HOM: Homozygote – Biến thể đồng hợp tử - NST: Nhiễm sắc thể - OD: optical density – Mật độ quang - PCBs: polychlorinated biphenyls - PCDDs: polychlorinated dibenzo-p-dioxin - PCR: Polymerase Chain Reaction – Phản ứng chuỗi polymerase - ppt: parts-per-trillion - Một phần nghìn tỉ - TCCD: tetrachlorodibenzo-p-dioxin - TCDD: 2,3,7,8-tetrachlorodibenzo-p-dioxin - TEFs/TEQ: toxic equivalance factors – Độ độc - WES: whole exome sequencing – Giải trình tự tồn hệ gen mã hóa - WGS: whole genome sequencing – Giải trình tự tồn hệ gen DANH MỤC CÁC BẢNG Bảng 2.1: Thể tích thành phần phản ứng 27 Bảng 3.2: Thông tin mẫu bệnh nhân gia đình nghiên cứu 31 Bảng 3.3: Nồng độ DNA tổng số 09 bệnh nhân 33 Bảng 3.4: Bảng thông tin chất lượng đọc mẫu giải trình tự 37 Bảng 3.4: Bảng gióng hàng liệu với hệ gen tham chiếu hg19 37 Bảng 3.5: Bảng SNP & INDEL 38 Bảng 3.6: Bảng biến thể di truyền gen bệnh nhân thiểu trí tuệ 40 DANH MỤC CÁC HÌNH Hình 2.1: Quy trình tạo thư viện DNA 24 Hình 2.2: Các bước giải trình tự gen hệ 26 Hình 2.3: Sơ đồ phương pháp nghiên cứu 30 Hình 3.2: Điện di đồ DNA tổng số mẫu bệnh phẩm 32 Hình 3.2 : Kết kiểm tra QC chất lượng DNA tổng số 34 Hình 3.3: Kết kiểm tra chất lượng thư viện DNA 35 Hình 3.4: Thống kê chất lượng liệu FastQ mẫu đọc lần 36 Hình 3.5: Thống kê chất lượng liệu FastQ mẫu đọc lần 36 Hình 3.6: Vị trí đột biến exon 10 gen FAT1 44 Hình 3.7: Sơ đồ phả hệ trình tự đột biến c.8798A>C (Gln2933Pro) gia đình bệnh nhân 45 Hình 3.8: Mơ hình mơ cấu trúc 3D chứa vị trí đột biến Gln2933Pro protein FAT1 46 MỤC LỤC MỞ ĐẦU CHƯƠNG I TỔNG QUAN 1.1 Tổng quan dioxin 1.2 Ảnh hưởng dioxin 1.3 Các loại bệ nh dioxin gây 1.4 Thiểu trí tuệ 1.5 Cơng nghệ giải trình tự gen hệ 1.6 Các nghiên cứu mức độ phân tử bệnh nhân dioxin Việt Nam đến CHƯƠNG II PHƯƠNG PHÁP NGHIÊN CỨU 2.1 Phương pháp thu mẫu máu 2.2 Hóa chất 2.3 Trang thiết bị 2.4 Phương pháp nghiên cứu 2.4.1 Tách chiết DNA tổng số 2.4.2 Điện di DNA gel agarose 2.4.3 Đo quang phổ DNA 2.4.4 Giải trình tự gen hệ 2.4.5 Nhân gen kĩ thuật PCR 2.4.6 Tinh sản phẩm PCR 2.4.7 Giải trình tự gen tự động máy Sanger CHƯƠNG III KẾT QUẢ VÀ THẢO LUẬN 3.1 Kết thu thập mẫu 3.2 Kết tách chiết DNA tổng số 3.3 Xác định nồng độ độ tinh mẫu DNA 3.4 Giải trình tồn vùng mã hóa 3.4.1 Bệnh nhân 3.4.2 Kết tạo thư viện DNA 3.5 Kết giải trình tự máy Illumina 3.5.1 Kết đọc trình tự mẫu bệnh nhân 3.5.2 Kết kiểm định chất lượng gióng hàng 3.5.3 Xác định biến thể di truyền bệnh nhân thiểu trí tuệ 3.6 Các biến thể liên quan đế bệnh ID 3.7 Giải trình tự gen tìm đột biến 3.8 Phân tích đột biến mơ hình cấu trúc protein chiều KẾT LUẬN TÀI LIỆU THAM KHẢO 3 11 15 17 18 20 20 21 21 21 21 22 23 23 26 28 29 31 31 32 32 33 33 35 36 36 37 38 39 42 45 47 48 MỞ ĐẦU Chất độc da cam/ dioxin gây hàng loạt bệnh khác có nhiều bệnh liên quan đến hệ thần kinh Rối loạn tâm thần 17 bệnh mà Việt Nam công nhận Các dị dạng, dị tật bẩm sinh, chậm phát triển trí tuệ (thiểu trí tuệ) phát hệ F1 F2 nạn nhân bị phơi nhiễm Giả thuyết chất độc da cam/ dioxin gây ảnh hưởng mức độ gen lên toàn hệ gen/ hệ gen biểu (exome) hay cấu trúc chức gen/ nhóm gen định dẫn tới phát sinh bệnh tật; thay đổi/ đột biến di truyền cho hệ cần phải chứng minh mặt khoa học Trí tuệ tính trạng phức tạp nhiều gen quy định Vì vậy, nghiên cứu ảnh hưởng thay đổi gen liên quan đến trí tuệ, dẫn đến thiểu trí tuệ cần tiến hành mức độ hệ gen, hệ gen biểu (exome) Đề tài tập trung giải vấn đề thông qua việc sàng lọc kỹ lưỡng, theo tiêu chuẩn quốc tế, đối tượng nạn nhân thuộc hệ con/ cháu gia đình có nạn nhân bị phơi nhiễm chất độc da cam/ dioxin Từ đó, tiến hành giải trình tự hệ gen biểu (exome) đối tượng, phân tích tin sinh thay đổi/ đột biến gen tìm hiểu mối liên hệ thay đổi cấu trúc chức gen với chế tác động dioxin chế phát sinh thiểu trí tuệ Mục đích luận văn: - Sàng lọc gen bị ảnh hưởng dioxin tìm đột biến có khả di truyền từ bố mẹ sang gây bệnh thiểu trí tuệ Nội dung tiến hành nghiên cứu: - Sàng lọc nạn nhân chất độc da cam/ dioxin sở hồ sơ, tài liệu, bệnh án có câu hỏi vấn thăm, khám - Tạo lưu giữ DNA từ bệnh nhân - Giải trình tự phân tích hệ gen biểu (exome) số gia đình có con/ cháu bị thiểu trí tuệ chất độc da cam/dioxin Qua đó, xác định biến dị di truyền liên quan đến thiểu trí tuệ Hình 3.8: Mơ hình mơ cấu trúc 3D chứa vị trí đột bi ến Gln2933Pro protein FAT1: A Người mang gen bình thường, B Người mang gen đột biến (Vị trí đột biến ký hiệu màu đỏ mũi tên màu xanh Liên kết hydro hình thành ký hiệu màu xanh ) Bằng phương pháp giải trình tự WES gia đình nạn nhân chất độc dioxin có bệnh nhân bị thiểu trí tuệ Việt Nam chúng tơi phát đột biến thay Gln2933Pro gen FAT1 Nghiên cứu di truyền phát đột biến di truyền trực tiếp từ người bố bị phơi nhiễm chất độc dioxin sang gái người bị thiểu trí tuệ, coi gen tiềm gây bệnh 46 KẾT LUẬN Kết luận 1: Sử dụng cơng nghệ giải trình tự gen hệ sàng lọc 92 biến thể liên quan đến ID Phát đột biến c.8798A>C, Gln2933Pro bệnh nhân di truyền từ người cha bị phơi nhiễm dioxin chiến tranh chống Mỹ Việt Nam Kết luận 2: Các nghiên cứu đóng góp cho khoa học, làm tiền đề cho nghiên cứu sâu hơn, phục vụ cho chẩn đốn điều trị bệnh thiểu trí tuệ Kiến nghị: Tiếp tục nghiên cứu giải trình tự exome số lượng lớn người bệnh thiểu trí tuệ di chứng dioxin để tìm đột biến di truyền gen có liên quan đến bệnh nhân di chứng dioxin từ chiến tranh Việt Nam 47 TÀI LIỆU THAM KHẢO Tiếng Việt Ban Chỉ đạo Quốc gia khắc phục hậu chất độc hoá học Mỹ sử dụng chiến tranh Việt Nam (2002), Chuyên khảo độc học dibenzo-p-dioxin clo hoá, Hà Nội Hồng Đình Cầu (2002), “Mơi trường sức khoẻ Việt Nam 30 năm sau chiến dịch Ranch-Hand”, Báo cáo tồn văn cơng trình khoa học Hội nghị khoa học Việt – Mỹ dioxin, tr 24-70 Hồng Đình Cầu, Trần Mạnh Hùng, Lê Thị Thái Hằng, Phùng Chí Dũng, Phạm Kim Cúc, Lê Thị Hồng Thơm (2000), “Phả hệ gia đình có dị tật bẩm sinh”, Kỷ yếu cơng trình 1980-2000 UB 10-80, Quyển 3(1) Phan Thị Phi Phi, Đỗ Hồ Bình, Trần Thị Chính, Nguyễn Thanh Thuý, Phan Thu Anh, Chu Thị Tuyết, Trương Mộng Trang, Vũ Triệu An (2000), “Nghiên cứu hậu muộn số tiêu miễn dịch tế bào cựu chiến binh sống vùng có chất rải dioxin”, Kỷ yếu cơng trình 1980-2000 UB 10-80, Quyển (2) Trần Xuân Thu (2003), “Bước đầu đánh giá mức độ ô nhiễm dioxin môi trường Việt Nam”, Các phương pháp xác định, xử lý đánh giá vùng ô nhiễm dioxin, tr.38-47 Yamamotos, MiuraH CS (1993), “Khám sức khoẻ ba vùng bị rải chất diệt cỏ làm rụng chiến tranh Việt Nam” , Chất diệt cỏ chiến tranh tác hại lâu dài người thiên nhiên -Hội thảo quốc tế lần thứ hai, tr 206-223 Nguyễn Văn Tuấn (2004), “Chất độc da cam, dioxin hệ quả”, Nhà xuất trẻ 48 Thông tư liên tịch số 41/2013/TTLT-BYT-BLĐTBXH ngày 28/11/2013 liên Bộ Y tế - Bộ Lao động thương binh xã hội “Hướng dẫn khám bệnh, tật, dị tật có liên quan đến phơi nhiễm với chất độc hóa học người hoạt động kháng chiến họ” Thông tư số 43/2011/TT – BYT “Quy định chế độ quản lý mẫu bệnh phẩm bệnh truyền nhiễm” 10 Sổ tay thu thập mẫu bệnh phẩm (2013), Khoa Vi rút, Viện Vệ sinh dịch tễ trung ương Tiếng Anh 11 Gies, A., G Neumeier, M Rappolder, and R Konietzka (2004), “Risk assessment of Dioxins and Dioxin-like PCBs in Food – Comments by the German Federal Environmental Agency”, in 24th International Symposium on Halogenated Environmental Organic Pollutants and Persistent Organic Pollutants (POPs)-dioxin 12 Stellman JM, Stellman SD, Weber T, Tomasallo C, Stellman AB, Christian RJrA (2003), “Geographic information system for characterizing exposure to Agent Orange and other herbicides in Vietnam”, Environ Health Perspect 111(3), p.321-328 13 National Academies of Science (2008), “Veterans and Agent Orange”, National Academies Press, Washington DC , p 14 Stellman, J et al (2003), “The Extent and Pattern of Usage of Agent Orange and other Herbicides in Viet Nam”, Nature, p 684-685 15 Boi, Phung Tuu (2008), “Agent Orange and the Environment: From Research to Remediation”, American Association of Asian Studies, Boston, MA, p 28 16 Tom Fawthrop (2004), “Vietnam's War against Agent Orange”, BBC News 17 WHO Media centre (2016), “Dioxin and their effects on human health” 49 18 U.S Department of Health and Human Services, “Agency for Toxic Substances & Disease Registry, Dioxin Policy Guidelines” , Washington DC, November 2008, p 380 19 Hatfield Consultants (2009), “Summary of Dioxin Contamination at Bien Hoa, Phu Cat and Da Nang Airbases Viet Nam”, PowerPoint presentation for the meeting of the U.S.-Vietnam Dialogue Group On Agent Orange/Dioxin, Washington, DC 20 Alcock RE, Jones KC (1996), “Dioxins in the environment: a review of trend data”, Environ Sci Technol, 30(11), p.3133–3143 21 Anna Sweeney (1994), “Reproductive Epidemiology of Dioxin”, Dioxin and Health, New york, p 549-586 22 Paepke O, Fuerst P, Malisch R, Ryan JJ, Schecter A (2003), “Dioxins in Vietnamese and Vietnamese environment: early and recent investigations”, 23 th international symposium on halogenated environmental organic pollutants & POPS 64, p 227-230 23 Schecter A, Pavuk M, Constable JD, Dai le C, Papke O (2002), “A follow-up: high level of dioxin contamination in Vietnamese from agent orange, three decades after the end of spraying”, J Occup Environ Med, 44(3), p.218-220 24 Institute of Medicine, Committee to Review the Health Effects in Vietnam Veterans of Exposure to Herbicides, Veterans and Agent Orange: Update 2012 Washington: National Academies Press, 2013 Accessed at http://books.nap.edu/openbook.php?record_id=18395 on January 27, 2014 25 H, Wen X (2002), “The epidemiology of mental retardation: challenges and opportunities in the new millennium”, Ment Retard Dev Disabil Res Rev , (8), p.117–134 26 Shevell M, Ashwal S, Donley D, Flint J, Gingold M, Hirtz D, Majnemer A, Noetzel M, Sheth RD (2003), “Practice parameter: evaluation of the child with global developmental delay: report of the Quality Standards Subcommittee of 50 the American Academy of Neurology and The Practice Committee of the Child Neurology Society”, Neurology, 60(3), p 367-80 27 Kaufman, L., Ayub, M and Vincent, J.B (2010), “The genetic basis of nonsyndromic intellectual disability: a review”, J Neurodev Disord, 2, p 182–209 28 Musante, L and Ropers, H.H (2014), “Genetics of recessive cognitive disorders”, Trends Genet, p 30, 32–39 29 Khan, M.A., Rafiq, M.A., Noor, A., Hussain, S., Flores, J.V., Rupp, V.,Vincent, A.K., Malli, R., Ali, G., Khan, F.S et al (2012), “Mutation in NSUN2, which encodes an RNA methlytransferase, causes autosomalrecessive intellectual disability”, Am J Hum Genet, p 90, 856–863 30 Takuji T, Masatoshi T (2005), "New insights into FAT cadherins", J Cell Sci 118(11), p 2347-2353 31 Jenny D, Andrew MH, Richard P, Tania AJ, Denise S, Wuu GC, Shi MD, Qiang Z, Peter CLB, Michael JO (1995), "Molecular cloning and tissue expression of FAT, the human homologue of the Drosophila fat gene that is located on chromosome 4q34–q35 and encodes a putative adhesion molecule", Genomics, (30), p 207-223 32 Holly NC, Nicole DD, Susan HS, Joycelyn ML, Patrice LW, Eminisha L, Natalia L, Ioanna K, Ryan CG, William FH, Derek VB, Vera M, Natalia KH, Michael AS, Eden RM, Jonathan LH, Michael LC, John RG and Margaret APV (2014), "Exome sequencing of extended families with autism reveals genes shared across neurodevelopmental and neuropsychiatric disorders", Molecular autism 5(1): p 2040-2392 33 Heon YG, Carolin ES, Pardeep KA, Jonathan DP, Toma AY, Markus S et al (2016), "FAT1 mutations cause a glomerulotubular nephropathy", Nat commun, p 10822- 10.1038 34 Erin LY, Rebecca SH, Jessica AH, and Merlin GB (2012), "12-year-old boy with a 4q35.2 microdeletion and involvement of MTNR1A, FAT1, and F11 genes", Clin Dysmorphol, 21(2), p 93-96 51 35 Abou JR, Becker T, Georgi A, Feulner T, Schumacher J, Stromaier J, et al (2008), "Genetic variation of the FAT gene at 4q35 is associated with bipolar affective disorder", Mol Psych, (13), p.277-284 36 Chien WH, Gau SSF, Wu YY, Huang US, Fang JS, Chen YJ, et al (2010), "Identification and molecular characterization of two novel chromosomal deletions associated with autism", Chin Genet (78), p 449-456 52 PHỤ LỤC Trình tự nucleotide gen FAT: ATGGGGAGACATTTGGCTTTGCTCCTGCTTCTGCTCCTTCTCTTCCAACATTTTGGAGACAGTGATGGCA GCCAACGACTTGAACAGACTCCTCTGCAGTTTACACACCTCGAGTACAACGTCACCGTGCAGGAGAACTC TGCAGCTAAGACTTATGTGGGGCATCCTGTCAAGATGGGTGTTTACATTACACATCCAGCGTGGGAAGTA AGGTACAAAATTGTTTCCGGAGACAGTGAAAACCTGTTCAAAGCTGAAGAGTACATTCTCGGAGACTTTT GCTTTCTAAGAATAAGGACCAAAGGAGGAAATACAGCTATTCTTAATAGAGAAGTGAAGGATCACTACAC ATTGATAGTGAAAGCACTTGAAAAAAATACTAATGTGGAGGCGCGAACAAAGGTCAGGGTGCAGGTGCTG GATACAAATGACTTGAGACCGTTATTCTCACCCACCTCATACAGCGTT TCTTTACCTGAAAACACAGCTA TAAGGACCAGTATCGCAAGAGTCAGCGCCACGGATGCAGACATAGGAACC AACGGGGAATTTTACTACAG TTTTAAAGATCGAACAGATATGTTTGCTATTCACCCAACCAGTGGTGTGATAGTG TTAACTGGTAGACTT GATTACCTAGAGACCAAGCTCTATGAGATGGAAATCCTCGCTGCGGACCGTGGCATGAAGTTGTATGGGA GCAGTGGCATCAGCAGCATGGCCAAGCTAACGGTGCACATCGAACAGGCCAATGAATGTGCTCCGGTGAT AACAGCAGTGACATTGTCACCATCAGAACTGGACAGGGACCCAGCATATGCAATTGTGACAGTGGATGAC TGCGATCAGGGTGCCAATGGTGACATAGCATCTTTAAGCATCGTGGCAGGTGACCTTCTCCAGCAGTTTA GAACAGTGAGGTCCTTTCCAGGGAGTAAGGAGTATAAAGTCAAAGCCATC GGTGGCATTGATTGGGACAG TCATCCTTTCGGCTACAATCTCACACTACAGGCTAAAGATAAAGGAACTCCGCCCCAGTTCTCTTCTGTT AAAGTCATTCACGTGACTTCTCCACAGTTCAAAGCCGGGCCAGTCAAGTTTGAAAAGGATGTTTACAGAG CAGAAATAAGTGAATTTGCTCCTCCCAACACACCTGTGGTCATGGTAAAGGCCATTCCTGCTTATTCCCA TTTGAGGTATGTTTTTAAAAGTACACCTGGAAAAGCTAAATTCAGTTTAAATTACAACACTGGTCTCATT TCTATTTTAGAACCAGTTAAAAGACAGCAGGCAGCCCATTTTGAACTTGAAGTAACA ACAAGTGACAGAA AAGCGTCCACCAAGGTCTTGGTGAAAGTCTTAGGTGCAAATAGCAATCCCCCTGAATTTACCCAGACAGC GTACAAAGCTGCTTTTGATGAGAACGTGCCCATTGGTACTACTGTCATGAGCCTGAGTGCCGTAGACCCT GATGAGGGTGAGAACGGGTACGTGACATACAGTATCGCAAATTTAAATCATGTGCCG TTTGCGATTGACC ATTTCACTGGTGCCGTGAGTACGTCAGAAAACCTGGACTACGAACTGATGCCTCGGGTTTATACTCTGAG GATTCGTGCATCAGACTGGGGCTTGCCGTACCGCCGGGAAGTCGAAGTCCTTGCTACAATTACTCTCAAT AACTTGAATGACAACACACCTTTGTTTGAGAAAATAAATTGTGAAGGGACAATTCCCAGAGATCTAGGCG TGGGAGAGCAAATAACCACTGTTTCTGCTATTGATGCAGATGAACTTCAGTTGGTACAGTATCAGATTGA AGCTGGAAATGAACTGGATTTCTTTAGTTTAAACCCCAACTCGGGGGTATTGTCATTAAAGCGATCGCTA ATGGATGGCTTAGGTGCAAAGGTGTCTTTCCACAGTCTGAGAATCACAGCTACAGATGGAGAAAATTTTG CCACACCATTATATATCAACATAACAGTGGCTGCCAGTCACAAGCTGGTAAACTTGCAGTGTGAAGAGAC TGGTGTTGCCAAAATGCTGGCAGAGAAGCTCCTGCAGGCAAATAAATTACACAACCAGGGAGAGGTGGAG GATATTTTCTTCGATTCTCACTCTGTCAATGCTCACATACCGCAGTTTAGAAGCACTCTTCCGACTGGTA TTCAGGTAAAGGAAAACCAGCCTGTGGGTTCCAGTGTAATTTTCATGAACTCCACTGACCTTGAC ACTGG CTTCAATGGAAAACTGGTCTATGCTGTTTCTGGAGGAAATGAGGATAGTTGCTTCATGATTGATATGGAA 53 ACAGGAATGCTGAAAATTTTATCTCCTCTTGACCGTGAAACAACAGACAAATACACCCTGAATATTACCG TCTATGACCTTGGGATACCCCAGAAGGCTGCGTGGCGTCTTCTACATGTCGTGGTTGTCGATGCCAATGA TAATCCACCCGAGTTTTTACAGGAGAGCTATTTTGTGGAAGTGAGTGAAGACAAGGAGGTACATAGTGAA ATCATCCAGGTTGAAGCCACAGATAAAGACCTGGGGCCCAACGGACACGTGACGTACTCAATTGTTACAG ACACAGACACATTTTCAATTGACAGCGTGACGGGTGTTGTTAACATCGCACGCCCTCTGGATCGAGAGCT GCAGCATGAGCACTCCTTAAAGATTGAGGCCAGGGACCAAGCCAGAGAAGAGCCTCAGCTGTTCTCCACT GTCGTTGTGAAAGTATCACTAGAAGATGTTAATGACAACCCACCTACATTTATTCCACCTAATTATCGTG TGAAAGTCCGAGAGGATCTTCCAGAAGGAACCGTCATCATGTGGTTAGAA GCCCACGATCCTGATTTAGG TCAGTCTGGTCAGGTGAGATACAGCCTTCTGGACCACGGAGAAGGAAACTTCGATGTGGATAAACTCAGT GGAGCAGTTAGGATCGTCCAGCAGTTGGACTTTGAGAAGAAGCAAGTGTATAATCTCACTGTGAGGGCCA AAGACAAGGGAAAGCCAGTTTCTCTGTCTTCTACTTGCTATGTTGAAGTTGAGGTGGTTGATGTGAATGA GAACCTGCACCCACCCGTGTTTTCCAGCTTTGTGGAAAAGGGGACAGTGAAAGAAGATGCACCTGTTGGT TCATTGGTAATGACGGTGTCGGCTCATGATGAGGACGCCAGAAGAGATGGGGAGATCCGATACTCCATTA GAGATGGCTCTGGCGTTGGTGTTTTCAAAATAGGTGAAGAGACAGGTGTCATAGAGACGTCAGATCGACT GGACCGTGAATCGACCTCCCATTATTGGCTAACAGTCTTTGCAACCGATCAGGGTGTCGTGCCTCTTTCA TCGTTCATAGAGATCTACATAGAGGTTGAGGATGTCAATGACAATGCACCACAGACATCAGAGCCTGTTT ATTACCCAGAAATCATGGAAAATTCTCCTAAAGATGTATCTGTGGTCCAGATCGAGGCATTTGATCCAGA TTCGAGCTCTAATGACAAGCTCATGTACAAAATTACAAGTGGAAATCCACAAGGATTCTTTTCAATACAT CCTAAAACAGGTCTCATCACAACTACGTCAAGGAAGCTAGACCGAGAACAGCAAGATGAACACATATTAG AGGTTACTGTGACAGACAATGGTAGTCCCCCCAAATCAACCATTGCAAGAGTCATTGTGAAAATCCTTGA TGAAAATGACAACAAACCTCAGTTTCTGCAAAAGTTCTACAAAATCAGACTCCCTGAGCGGGAAAAGCCA GACCGAGAAAGAAATGCCAGACGGGAGCCGCTCTATCACGTCATAGCCACCGACAAGGATGAGGGCCCCA ATGCAGAAATCTCCTACAGCATCGAAGACGGGAATGAGCATGGCAAATTTTTCATCGAACCGAAAACTGG AGTGGTTTCGTCCAAGAGGTTTTCAGCAGCTGGAGAATATGATATTCTTTCAATTAAGGCAGTTGACAAT GGTCGCCCTCAAAAGTCATCAACCACCAGACTCCATATTGAATGGATCTCCAAGCCCAAACCGTCCCTGG AGCCCATTTCATTTGAAGAATCATTTTTTACCTTTACTGTGATGGAAAGTGACCCCGTTGCTCACATGAT TGGAGTAATATCTGTGGAGCCTCCTGGCATACCCCTTTGGTTTGACATCACTGGTGGCAACTACGACAGT CACTTCGATGTGGACAAGGGAACTGGAACCATCATTGTTGCCAAA CCTCTTGATGCAGAACAGAAGTCAA ACTACAACCTCACAGTCGAGGCTACAGATGGAACCACCACTATCCTCACTCAGGTATTCATCAAAGTAAT AGACACAAATGACCATCGTCCTCAGTTTTCTACATCAAAGTATGAAGTTGTTATTCCTGAAGATACAGCG CCAGAAACAGAAATTTTGCAAATCAGTGCTGTGGATCAGGATGAG AAAAACAAACTAATCTACACTCTGC AGAGCAGTAGAGATCCACTGAGTCTCAAGAAATTTCGTCTTGATCCTGCAACCGGCTCTCTCTATACTTC TGAGAAACTGGATCATGAAGCTGTTCACCAGCACACCCTCACG GTCATGGTACGAGATCAAGATGTGCCT GTAAAACGCAACTTTGCAAGGATTGTGGTCAATGTCAGCGACACGAATGACCACGCCCCGTGGTTCACCG CTTCCTCCTACAAAGGGCGGGTTTATGAATCGGCAGCCGTTGGCTCAGTTGTGTTGCAGGTGACGGCTCT GGACAAGGACAAAGGGAAAAATGCTGAAGTGCTGTACTCGATCGAGTCAGGAAATATTGGAAATTCTTTT ATGATTGATCCTGTCTTGGGCTCTATTAAAACTGCCAAAGAATTAGATCGAAGTAACCAAGCGGAGTATG 54 ATTTAATGGTAAAAGCTACAGATAAGGGCAGTCCACCAATGAGTGAAATAACTTCTGTGCGTATCTTTGT CACAATTGCTGACAACGCCTCTCCGAAGTTTACATCAAAAGAATATTCTGTTGAACTTAGTGAAACTGTC AGCATTGGGAGTTTCGTTGGGATGGTTACAGCCCATAGTCAATCATCAGTGGTGTATGAAATAAAAGATG GAAATACAGGTGATGCTTTTGATATTAATCCACATTCTGGAACTATCATCACTCAGAAAGCCCTGGACTT TGAAACTTTGCCCATTTACACATTGATAATACAAGGAACTAACATGGCTGGTTTGTCCACTAATACAACG GTTCTAGTTCACTTGCAGGATGAGAATGACAACGCGCCAGTTTTTATGCAGGCAGAATATACAGGACTCA TTAGTGAATCAGCCTCAATTAACAGCGTGGTCCTAACAGACAGGAATGTCCCACTGGTGATTCGAGCAGC TGATGCTGATAAAGACTCAAATGCTTTGCTTGTATATCACATTGTTGAACCATCTGTACACACATATTTT GCTATTGATTCTAGCACTGGTGCTATTCATACAGTACTAAGTCTGGACTATGAAGAAACAAGTATTTTTC ACTTTACCGTCCAAGTGCATGACATGGGAACCCCACGTTTATTTGCTGAGTATGCAGCGAATGTAACAGT ACATGTAATTGACATTAATGACTGCCCCCCTGTGTTTGCCAAGCCATTATATGAAGCATCTCTTTTGTTA CCAACATACAAAGGAGTAAAAGTCATCACAGTAAATGCTACAGATGCTGATTCAAGTGCATTCTCACAGT TGATTTACTCCATCACCGAAGGCAACATCGGGGAGAAGTTTTCTATGGACTACAAGACTGGTGCTCTCAC TGTCCAAAACACAACTCAGTTAAGAAGCCGCTACGAGCTAACCGTTAGAGCTTCCGATGGCAGATTTGCC GGCCTTACCTCTGTCAAAATTAATGTGAAAGAAAGCAAAGAAAGTCACCTAAAGTTTACCCAGGATGTCT ACTCTGCGGTAGTGAAAGAGAATTCCACCGAGGCCGAAACATTAGCTGTCATTACTGCTATTGGGAATCC AATCAATGAGCCTTTGTTTTATCACATCCTCAACCCAGATCGCAGATTTAAAATAAGCCGCACTTCAGGA GTTCTGTCAACCACTGGCACGCCCTTCGATCGTGAGCAGCAGGAGGCGTTTGATGTGGTTGTAGAAGTGA CAGAGGAACATAAGCCTTCTGCAGTGGCCCACGTTGTCGTGAAGGTCATTGTAGAAGACCAAAATGATAA TGCGCCGGTGTTTGTCAACCTTCCCTACTACGCCGTTGTTAAAGTGGACACTGAGGTGGGCCATGTCATT CGCTATGTCACTGCTGTAGACAGAGACAGTGGCAGAAACGGGGAAGTGCATTACTACCTCAAGGAACATC ATGAACACTTTCAAATTGGACCCTTGGGTGAAATTTCACTGAAAAAGCAATTTGAGCTTGACACCTTAAA TAAAGAATATCTTGTTACAGTGGTTGCAAAAGATGGAGGGAACCCGGCCTTTTCAGCGGAAGTTATCGTT CCGATCACTGTCATGAATAAAGCCATGCCTGTGTTTGAAAAACCTTTCTACAGTGCAGAGATTGCAGAGA GCATCCAGGTGCACAGCCCTGTGGTCCACGTGCAGGCTAACAGCCCGGAAGGCCTGAAAGTGTTCTACAG CATCACAGACGGAGACCCTTTCAGCCAGTTCACTATTAACTTCAATACTGGAGTTATCAATGTCATAGCT CCTCTGGACTTTGAGGCCCACCCGGCATATAAGCTGAGCATACGCGCAACTGACTCCTTGACGGGCGCTC ATGCTGAAGTATTTGTGGACATCATAGTAGACGACATCAATGATAACCCTCCTGTGTTTGCTCAGCAGTC TTATGCGGTGACCCTGTCTGAGGCATCTGTAATTGGAACGTCTGTTGTTCAAGTTAGAGCCACCGATTCT GATTCAGAACCAAATAGAGGAATCTCATACCAGATGTTTGGGAATCACAGCAAGAGTCATGATCATTTTC ATGTAGACAGCAGCACTGGCCTCATCTCACTACTCAGAACCCTGGATTACGAGCAGTCCCGGCAGCACAC GATTTTTGTGAGGGCAGTTGATGGTGGTATGCCCACGCTGAGCAGTGATGTGATTGTCACGGTGGACGTT ACCGACCTCAATGATAATCCACCACTCTTTGAACAACAGATTTATGAAGCCAGAATTAGCGAGCACGCCC CTCATGGGCATTTCGTGACCTGTGTAAAAGCCTATGATGCAGACAGTTCAGACATAGACAAGTTGCAGTA TTCCATTCTGTCTGGCAATGATCATAAACATTTTGTCATTGACAGTGCAACAGGGATTATCACCCTCTCA AACCTGCACCGGCACGCCCTGAAGCCATTTTACAGTCTTAACCTGTCAGTGTCTGATGGAGTTTTTAGAA GTTCCACCCAGGTTCATGTAACTGTAATTGGAGGCAATTTGCACAGTCCTGCTTTCCTTCAGAACGAATA 55 TGAAGTGGAACTAGCTGAAAACGCTCCCCTACATACCCTGGTGATGGAGGTGAAAACTACGGATGGGGAT TCTGGTATTTATGGTCACGTTACTTACCATATTGTAAATGACTTTGCCAAAGACAGATTTTACATAAATG AGAGAGGACAGATATTTACTTTGGAAAAACTTGATCGAGAAACCCCGGCGGAGAAAGTGATCTCAGTCCG TTTAATGGCTAAGGATGCTGGAGGAAAAGTTGCTTTCTGCACCGTGAATGTCATCCTTACAGATGACAAT GACAATGCACCACAATTTCGAGCAACCAAATACGAAGTGAATATCGGGTCCAGTGCTGCTAAAGGGACTT CAGTCGTTAAAGTTCTTGCAAGTGATGCCGATGAGGGCTCCAATGCCGACATCACCTATGCCATTGAAGC AGACTCTGAAAGTGTAAAAGAGAATTTGGAAATTAACAAACTGTCCGGCGTAATCACTACAAAGGAGAGC CTCATTGGCTTGGAAAATGAATTCTTCACTTTCTTTGTTAGAGCTGTGGATAATGGGTCTCCATCAAAAG AATCTGTTGTTCTTGTCTATGTTAAAATCCTTCCACCGGAAATGCAGCTTCCAAAATTTTCAGAACCTTT CTATACCTTTACAGTGTCAGAGGACGTGCCTATTGGAACAGAGATAGATCTCATCCGAGCAGAACATAGT GGGACTGTTCTTTACAGCCTGGTCAAAGGGAATACTCCAGAAAGCAATAGGGATGAGTCCTTTGTGATTG ACAGACAGAGCGGGAGACTGAAGTTGGAGAAGAGTCTTGATCATGAGACAACTAAGTGGTATCAGTTTTC CATACTGGCCAGGTGCACTCAAGATGACCATGAGATGGTGGCTTCTGTAGATGTTAGTATCCAAGTGAAA GATGCAAATGACAACAGCCCGGTCTTTGAATCTAGTCCATATGAGGCATTCATTGTTGAAAACCTGCCAG GGGGAAGTAGAGTAATTCAGATCAGGGCATCTGATGCTGACTCAGGAACCAACGGCCAAGTTATGTATAG CCTGGATCAGTCACAAAGTGTGGAAGTCATTGAATCCTTTGCCATTAACATGGAAACAGGCTGGATTACA ACTTTAAAGGAACTTGACCATGAAAAGAGAGACAATTACCAGATTAAAGTGGTTGCATCAGATCATGGTG AAAAGATCCAGCTATCCTCCACAGCCATTGTGGATGTTACCGTCACCGATGTCAACGATAGTCCACCACG ATTCACGGCCGAGATCTATAAAGGGACTGTGAGTGAGGATGACCCCCAAGGTGGGGTGATTGCCATCTTA AGTACCACGGATGCTGATTCTGAAGAGATCAACAGACAAGTTACATATTTCATAACAGGAGGGGATCCTT TAGGACAGTTTGCCGTTGAAACTATACAGAATGAATGGAAGGTATATGTGAAGAAACCTCTAGACAGGGA AAAAAGGGACAATTACCTTCTTACTATCACGGCAACTGATGGCACCTTCTCATCAAAAGCGATAGTTGAA GTGAAAGTTCTGGATGCAAATGACAACAGTCCAGTTTGTGAAAAGACTTTATATTCAGACACTATTCCTG AAGACGTCCTTCCTGGAAAATTGATCATGCAGATCTCTGCTACAGACGCAGACATCCGCTCTAACGCTGA AATTACTTACACGTTATTGGGTTCAGGTGCAGAAAAATTCAAA CTAAATCCAGACACAGGTGAACTGAAA ACGTCAACCCCCCTTGATCGTGAGGAGCAAGCTGTTTATCATCTTCTCGTCAGGGCCACAGATGGAGGAG GAAGATTCTGCCAAGCCAGTATTGTGCTCACGCTAGAAGATGTGAACGATAACGCCCCCGAATTCTCTGC CGATCCTTATGCCATCACCGTGTTTGAAAACACAGAGCCGGGAACGCTGCTGACAAGAGTGCAGGCCACA GATGCCGACGCAGGATTAAATCGGAAGATTTTATACTCACTGATTGACTCTGCTGATGGGCAGTTCTCCA TTAACGAATTATCTGGAATTATTCAGTTAGAAAAACCTTTGGACAGAGAACTCCAGGCAGTATACACCCT CTCTTTGAAAGCTGTGGATCAAGGCTTGCCAAGGAGGCTGACTGCCACTGGCACTGTGATTGTATCAGTT CTTGACATAAATGACAACCCCCCTGTGTTTGAGTACCGTGAATATGGTGCCACCGTGTCTGAGGACATTC TTGTTGGAACTGAAGTTCTTCAAGTGTATGCAGCAAGTCGGGATATTGAAGCAAATGCAGAAATCACCTA CTCAATAATAAGTGGAAATGAACATGGGAAATTCAGCATAGATTCTAAAACAGGGGCCGTATTTATCATT GAGAATCTGGATTATGAGAGCTCTCATGAGTATTACCTAACAGTAGAGGCCACTGATGGAGGCACGCCTT CACTGAGCGACGTTGCCACTGTGAACGTTAATGTAACAGATATCAACGAT AATACCCCTGTGTTCAGCCA AGACACCTACACGACAGTCATCAGTGAAGATGCCGTTCTTGAGCAGTCTGTCATCACGGTTATGGCCGAT 56 GATGCCGATGGACCTTCCAACAGCCACATCCACTACTCAATTATAGATGGCAACCAAGGAAGCTCGTTCA CAATTGACCCCGTCAGGGGAGAAGTCAAAGTGACCAAACTTCTCGACCGAGAAACGATTTCAGGTTACAC GCTCACGGTTCAAGCTTCTGATAATGGCAGTCCACCCAGAGTCAACACGACGACCGTGAACATCGATGTG TCCGATGTCAATGACAACGCGCCCGTCTTCTCCAGGGGAAACTACAGTGTCATTATCCAGGAAAATAAGC CAGTGGGCTTCAGCGTGCTGCAGCTGGTAGTAACAGATGAGGATTCTTCCCATAACGGTCCACCCTTCTT CTTTACTATTGTAACTGGAAATGATGAGAAGGCTTTTGAAGTTAACCCGCAAGGAGTCCTCCTGACATCA TCTGCCATCAAGAGGAAGGAGAAAGATCATTACTTACTGCAGGTGAAGGTGGCAGATAATGGAAAGCCTC AGTTGTCATCTTTGACATACATTGACATTAGGGTAATTGAGGAGAGCATCTATCCGCCTGCGATTTTGCC CCTGGAGATTTTCATCACCTCTTCTGGAGAAGAATACTCAGGTGGCGTCATTGGGAAGATCCATGCCACA GACCAGGACGTGTATGATACTCTAACCTACAGTCTCGACCCTCAGATGGACAACCTGTTCTCTGTTTCCA GCACAGGGGGCAAGCTGATAGCACACAAAAAGCTAGACATAGGGCAATACCTTCTCAATGTCAGCGTAAC AGATGGGAAGTTCACGACGGTGGCCGACATCACAGTGCATATCAGACAAGTCACACAGGAGATGTTGAAC CACACCATCGCGATCCGCTTTGCCAACCTCACTCCGGAAGAATTCGTTGGTGACTACTGGCGCAACTTCC AGCGAGCTTTACGGAACATCCTGGGTGTGAGGAGGAACGACATACAGATTGTTAGTTTGCAGTCCTCTGA ACCTCACCCACATCTGGACGTCTTACTTTTTGTAGAGAAACCAGGTAGTGCTCAGATCTCAACAAAACAA CTTCTGCACAAGATTAACTCTTCCGTGACTGACATTGAGGAAATCATTGGAGTTAGGATACTGAATGTAT TCCAGAAACTCTGCGCGGGACTGGACTGCCCCTGGAAGTTCTGCGATGAAAAGGTGTCTGTGGATGAAAG TGTGATGTCAACACACAGCACAGCCAGACTGAGTTTTGTGACTCCCCGCCACCACAGGGCAGCGGTGTGT CTCTGCAAAGAGGGAAGGTGCCCACCTGTCCACCATGGCTGTGAAGATGATCCGTGCCCTGAGGGATCCG AATGTGTGTCTGATCCCTGGGAGGAGAAACACACCTGTGTCTGTCCCAGCGGCAGGTTTGGTCAGTGCCC AGGGAGTTCATCTATGACACTGACTGGAAACAGCTACGTGAAATACCGTCTGACGGAAAATGAAAACAAA TTAGAGATGAAACTGACCATGAGGCTCAGAACATATTCCACGCATGCGGTTGTCATGTATGCTCGAGGAA CTGACTATAGCATCTTGGAGATTCATCATGGAAGGCTGCAGTACAAGTTTGACTGTGGAAGTGGCCCTGG AATTGTCTCTGTTCAGAGCATTCAGGTCAATGATGGGCAGTGGCACGCAGTGGCCCTGGAAGTGAATGGA AACTATGCTCGCTTGGTTCTAGACCAAGTTCATACTGCATCGGGCACAGCCCCAGGGACTCTGAAAACCC TGAACCTGGATAACTATGTGTTTTTTGGTGGCCACATCCGTCAGCAGGGAACAAGGCATGGAAGAAGTCC TCAAGTTGGTAATGGTTTCAGGGGTTGTATGGACTCCATTTATTTGAATGGGCAGGAGCTCCCTTTAAAC AGCAAACCCAGAAGCTATGCACACATCGAAGAGTCGGTGGATGTATCTCCAGGCTGCTTCCTGACGGCCA CGGAAGACTGCGCCAGCAACCCTTGCCAGAATGGAGGCGTTTGCAATCCGTCACCTGCTGGAGGTTATTA CTGCAAATGCAGTGCCTTGTACATAGGGACCCACTGTGAGATAAGCGTCAATCCGTGTTCCTCCAAGCCA TGCCTCTATGGGGGCACGTGTGTTGTCGACAACGGAGGCTTTGTTTGCCAGTGTAGAGGATTATATACTG GTCAGAGGTGTCAGCTTAGTCCATACTGCAAAGATGAACCCTGTAAGAATGGCGGAACATGCTTTGACAG TTTGGATGGCGCCGTTTGTCAGTGTGATTCGGGTTTTAGGGGAGAAAGGTGTCAGAGTGATATCGACGAG TGCTCTGGAAACCCTTGCCTGCACGGGGCCCTCTGTGAGAACACGCACGGCTCCTATCACTGCAACTGCA GCCACGAGTACAGGGGACGTCACTGCGAGGATGCTGCGCCCAACCAGTATGTGTCCACGCCGTGGAACAT TGGGTTGGCGGAAGGAATTGGAATCGTTGTGTTTGTTGCAGGGATATTTTTACTGGTGGTGGTGTTTGTT CTCTGCCGTAAGATGATTAGTCGGAAAAAGAAGCATCAGGCTGAACCTAAAGACAAGCACCTGGGACCCG 57 CTACGGCTTTCTTGCAAAGACCGTATTTTGATTCCAAGCTAAATAAGAACATTTACTCAGACATACCACC CCAGGTGCCTGTCCGGCCTATTTCCTACACCCCGAGTATTCCAAGTGACTCAAGAAACAATCTGGACCGA AATTCCTTCGAAGGATCTGCTATCCCAGAGCATCCCGAATTCAGCACTTTTAACCCCGAGTCTGTGCACG GGCACCGAAAAGCAGTGGCGGTCTGCAGCGTGGCGCCAAACCTGCCTCCCCCACCCCCTTCAAACTCCCC TTCTGACAGCGACTCCATCCAGAAGCCTAGCTGGGACTTTGACTATGACACAAAAGTGGTGGATCTTGAT CCCTGTCTTTCCAAGAAGCCTCTAGAGGAAAAGCCTTCCCAGCCATACAGTGCCCGGGAAAGCCTGTCTG AAGTGCAGTCTCTGAGCTCCTTCCAGTCCGAATCGTGCGATGACAATGGGTATCACTGGGATACATCAGA TTGGATGCCAAGCGTTCCTCTGCCGGACATACAAGAGTTCCCCAACTATGAGGTGATTGATGAGCAGACA CCCCTGTACTCAGCAGATCCAAACGCCATCGATACGGACTATTACCCTGGAGGCTACGACATCGAAAGTG ATTTTCCTCCACCCCCAGAAGACTTCCCCGCAGCTGATGAGCTACCACCGTTACCGCCCGAATTCAGCAA TCAGTTTGAATCCATCCACCCTCCTAGAGACATGCCTGCCGCGGGTAGCTTGGGTTCTTCATCAAGAAAC CGGCAGAGGTTCAACTTGAATCAGTATTTGCCCAATTTTTATCCCCTCGATATGTCTGAACCTCAAACAA AAGGCACTGGTGAGAATAGTACTTGTAGAGAACCCCATGCCCCTTACCCGCCAGGGTATCAAAGACACTT CGAGGCGCCCGCTGTCGAGAGCATGCCCATGTCTGTGTACGCCTCCACCGCCTCCTGCTCTGACGTGTCA GCCTGCTGCGAAGTGGAGTCCGAGGTCATGATGAGTGACTATGAGAGCGGGGACGACGGCCACTTCGAAG AGGTGACGATCCCGCCCCTGGATTCCCAGCAGCACACGGAAGTCTGA Chú thích: - Vị trí thiết kế mồi cho phản ứng khuếch đại đoạn gen nghiên cứu (bôi màu vàng): Đoạn mồi là: FA-F-5’-CGTGCCTATTGGAACAGAGATAG- 3’ FA-R-5’- AGTACCACGGATGCTGATTC – 3’ - Vị trí nucleotide bị đột biến (bôi màu xanh): Nucleotide Adenine bị đột biến thành Cytosine 58 Trình tự axit amin protein FAT1 MGRHLALLLLLLLLFQHFGDSDGSQRLEQTPLQFTHLEYNVTVQENSAAKTYVGHPVKMGVYITHPAWEV RYKIVSGDSENLFKAEEYILGDFCFLRIRTKGGNTAILNREVKDHYTLIVKALEKNTNVEARTKVRVQVL DTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGTNGEFYYSFKDRTDMFAIHPTSGVIVLTGRL DYLETKLYEMEILAADRGMKLYGSSGISSMAKLTVHIEQANECAPVITAVTLSPSELDRDPAYAIVTVDD CDQGANGDIASLSIVAGDLLQQFRTVRSFPGSKEYKVKAIGGIDWDSHPFGYNLTLQAKDKGTPPQFSSV KVIHVTSPQFKAGPVKFEKDVYRAEISEFAPPNTPVVMVKAIPAYSHLRYVFKSTPGKAKFSLNYNTGLI SILEPVKRQQAAHFELEVTTSDRKASTKVLVKVLGANSNPPEFTQTAYKAAFDENVPIGTTVMSLSAVDP DEGENGYVTYSIANLNHVPFAIDHFTGAVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLN NLNDNTPLFEKINCEGTIPRDLGVGEQITTVSAIDADELQLVQYQIEAGNELDFFSLNPNSGVLSLKRSL MDGLGAKVSFHSLRITATDGENFATPLYINITVAASHKLVNLQCEETGVAKMLAEKLLQANKLHNQGEVE DIFFDSHSVNAHIPQFRSTLPTGIQVKENQPVGSSVIFMNSTDLDTGFNGKLVYAVSGGNEDSCFMIDME TGMLKILSPLDRETTDKYTLNITVYDLGIPQKAAWRLLHVVVVDANDNPPEFLQESYFVEVSEDKEVHSE IIQVEATDKDLGPNGHVTYSIVTDTDTFSIDSVTGVVNIARPLDRELQHEHSLKIEARDQAREEPQLFST VVVKVSLEDVNDNPPTFIPPNYRVKVREDLPEGTVIMWLEAHDPDLGQSGQVRYSLLDHGEGNFDVDKLS GAVRIVQQLDFEKKQVYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHPPVFSSFVEKGTVKEDAPVG SLVMTVSAHDEDARRDGEIRYSIRDGSGVGVFKIGEETGVIETSDRLDRESTSHYWLTVFATDQGVVPLS SFIEIYIEVEDVNDNAPQTSEPVYYPEIMENSPKDVSVVQIEAFDPDSSSNDKLMYKITSGNPQGFFSIH PKTGLITTTSRKLDREQQDEHILEVTVTDNGSPPKSTIARVIVKILDENDNKPQFLQKFYKIRLPEREKP DRERNARREPLYHVIATDKDEGPNAEISYSIEDGNEHGKFFIEPKTGVVSSKRFSAAGEYDILSIKAVDN GRPQKSSTTRLHIEWISKPKPSLEPISFEESFFTFTVMESDPVAHMIGVISVEPPGIPLWFDITGGNYDS HFDVDKGTGTIIVAKPLDAEQKSNYNLTVEATDGTTTILTQVFIKVIDTNDHRPQFSTSKYEVVIPEDTA PETEILQISAVDQDEKNKLIYTLQSSRDPLSLKKFRLDPATGSLYTSEKLDHEAVHQHTLTVMVRDQDVP VKRNFARIVVNVSDTNDHAPWFTASSYKGRVYESAAVGSVVLQVTALDKDKGKNAEVLYSIESGNIGNSF MIDPVLGSIKTAKELDRSNQAEYDLMVKATDKGSPPMSEITSVRIFVTIADNASPKFTSKEYSVELSETV SIGSFVGMVTAHSQSSVVYEIKDGNTGDAFDINPHSGTIITQKALDFETLPIYTLIIQGTNMAGLSTNTT VLVHLQDENDNAPVFMQAEYTGLISESASINSVVLTDRNVPLVIRAADADKDSNALLVYHIVEPSVHTYF AIDSSTGAIHTVLSLDYEETSIFHFTVQVHDMGTPRLFAEYAANVTVHVIDINDCPPVFAKPLYEASLLL PTYKGVKVITVNATDADSSAFSQLIYSITEGNIGEKFSMDYKTGALTVQNTTQLRSRYELTVRASDGRFA GLTSVKINVKESKESHLKFTQDVYSAVVKENSTEAETLAVITAIGNPINEPLFYHILNPDRRFKISRTSG VLSTTGTPFDREQQEAFDVVVEVTEEHKPSAVAHVVVKVIVEDQNDNAPVFVNLPYYAVVKVDTEVGHVI RYVTAVDRDSGRNGEVHYYLKEHHEHFQIGPLGEISLKKQFELDTLNKEYLVTVVAKDGGNPAFSAEVIV PITVMNKAMPVFEKPFYSAEIAESIQVHSPVVHVQANSPEGLKVFYSITDGDPFSQFTINFNTGVINVIA PLDFEAHPAYKLSIRATDSLTGAHAEVFVDIIVDDINDNPPVFAQQSYAVTLSEASVIGTSVVQVRATDS DSEPNRGISYQMFGNHSKSHDHFHVDSSTGLISLLRTLDYEQSRQHTIFVRAVDGGMPTLSSDVIVTVDV TDLNDNPPLFEQQIYEARISEHAPHGHFVTCVKAYDADSSDIDKLQYSILSGNDHKHFVIDSATGIITLS NLHRHALKPFYSLNLSVSDGVFRSSTQVHVTVIGGNLHSPAFLQNEYEVELAENAPLHTLVMEVKTTDGD SGIYGHVTYHIVNDFAKDRFYINERGQIFTLEKLDRETPAEKVISVRLMAKDAGGKVAFCTVNVILTDDN 59 DNAPQFRATKYEVNIGSSAAKGTSVVKVLASDADEGSNADITYAIEADSESVKENLEINKLSGVITTKES LIGLENEFFTFFVRAVDNGSPSKESVVLVYVKILPPEMQLPKFSEPFYTFTVSEDVPIGTEIDLIRAEHS GTVLYSLVKGNTPESNRDESFVIDRQSGRLKLEKSLDHETTKWYQFSILARCTQDDHEMVASVDVSIQVK DANDNSPVFESSPYEAFIVENLPGGSRVIQIRASDADSGTNGQVMYSLDQSQSVEVIESFAINMETGWIT TLKELDHEKRDNYQIKVVASDHGEKIQLSSTAIVDVTVTDVNDSPPRFTAEIYKGTVSEDDPQGGVIAIL STTDADSEEINRQVTYFITGGDPLGQFAVETIQNEWKVYVKKPLDREKRDNYLLTITATDGTFSSKAIVE VKVLDANDNSPVCEKTLYSDTIPEDVLPGKLIMQISATDADIRSNAEITYTLLGSGAEKFKLNPDTGELK TSTPLDREEQAVYHLLVRATDGGGRFCQASIVLTLEDVNDNAPEFSADPYAITVFENTEPGTLLTRVQAT DADAGLNRKILYSLIDSADGQFSINELSGIIQLEKPLDRELQAVYTLSLKAVDQGLPRRLTATGTVIVSV LDINDNPPVFEYREYGATVSEDILVGTEVLQVYAASRDIEANAEITYSIISGNEHGKFSIDSKTGAVFII ENLDYESSHEYYLTVEATDGGTPSLSDVATVNVNVTDINDNTPVFSQDTYTTVISEDAVLEQSVITVMAD DADGPSNSHIHYSIIDGNQGSSFTIDPVRGEVKVTKLLDRETISGYTLTVQASDNGSPPRVNTTTVNIDV SDVNDNAPVFSRGNYSVIIQENKPVGFSVLQLVVTDEDSSHNGPPFFFTIVTGNDEKAFEVNPQGVLLTS SAIKRKEKDHYLLQVKVADNGKPQLSSLTYIDIRVIEESIYPPAILPLEIFITSSGEEYSGGVIGKIHAT DQDVYDTLTYSLDPQMDNLFSVSSTGGKLIAHKKLDIGQYLLNVSVTDGKFTTVADITVHIRQVTQEMLN HTIAIRFANLTPEEFVGDYWRNFQRALRNILGVRRNDIQIVSLQSSEPHPHLDVLLFVEKPGSAQISTKQ LLHKINSSVTDIEEIIGVRILNVFQKLCAGLDCPWKFCDEKVSVDESVMSTHSTARLSFVTPRHHRAAVC LCKEGRCPPVHHGCEDDPCPEGSECVSDPWEEKHTCVCPSGRFGQCPGSSSMTLTGNSYVKYRLTENENK LEMKLTMRLRTYSTHAVVMYARGTDYSILEIHHGRLQYKFDCGSGPGIVSVQSIQVNDGQWHAVALEVNG NYARLVLDQVHTASGTAPGTLKTLNLDNYVFFGGHIRQQGTRHGRSPQVGNGFRGCMDSIYLNGQELPLN SKPRSYAHIEESVDVSPGCFLTATEDCASNPCQNGGVCNPSPAGGYYCKCSALYIGTHCEISVNPCSSKP CLYGGTCVVDNGGFVCQCRGLYTGQRCQLSPYCKDEPCKNGGTCFDSLDGAVCQCDSGFRGERCQSDIDE CSGNPCLHGALCENTHGSYHCNCSHEYRGRHCEDAAPNQYVSTPWNIGLAEGIGIVVFVAGIFLLVVVFV LCRKMISRKKKHQAEPKDKHLGPATAFLQRPYFDSKLNKNIYSDIPPQVPVRPISYTPSIPSDSRNNLDR NSFEGSAIPEHPEFSTFNPESVHGHRKAVAVCSVAPNLPPPPPSNSPSDSDSIQKPSWDFDYDTKVVDLD PCLSKKPLEEKPSQPYSARESLSEVQSLSSFQSESCDDNGYHWDTSDWMPSVPLPDIQEFPNYEVIDEQT PLYSADPNAIDTDYYPGGYDIESDFPPPPEDFPAADELPPLPPEFSNQFESIHPPRDMPAAGSLGSSSRN RQRFNLNQYLPNFYPLDMSEPQTKGTGENSTCREPHAPYPPGYQRHFEAPAVESMPMSVYASTASCSDVS ACCEVESEVMMSDYESGDDGHFEEVTIPPLDSQQHTEV Chú thích: - Màu xanh đánh dấu vị trí axit amin bị biến đổi, kí hiệu Q viết tắt axit amin Glutamine, sau đột biến trở thành axit amin Proline kí hiệu P 60 ... VIỆN ĐẠI HỌC MỞ HÀ NỘI LUẬN VĂN THẠC SĨ PHÂN TÍCH HỆ GEN BIỂU HIỆN (EXOME) Ở CON CỦA NẠN NHÂN CHẤT ĐỘC DA CAM/ DIOXIN BỊ THIỂU NĂNG TRÍ TUỆ NGUYỄN THỊ HIỀN CHUYÊN NGÀNH : CÔNG NGHỆ SINH HỌC MÃ... trí tuệ (thiểu trí tuệ) phát hệ F1 F2 nạn nhân bị phơi nhiễm Giả thuyết chất độc da cam/ dioxin gây ảnh hưởng mức độ gen lên toàn hệ gen/ hệ gen biểu (exome) hay cấu trúc chức gen/ nhóm gen định... tự hệ gen biểu (exome, chiếm khoảng 1% toàn hệ gen) số nạn nhân chất độc da cam/ dioxin bị thiểu trí tuệ cơng nghệ giải trình tự hệ Qua đó, phát đa hình/ đột biến gen liên quan đến nguyên nhân
- Xem thêm -

Xem thêm: Phân tích hệ gen biểu hiện (exome) ở con của nạn nhân chất độc da cam dioxin bị thiểu năng trí tuệ , Phân tích hệ gen biểu hiện (exome) ở con của nạn nhân chất độc da cam dioxin bị thiểu năng trí tuệ

Gợi ý tài liệu liên quan cho bạn