0
  1. Trang chủ >
  2. Cao đẳng - Đại học >
  3. Kỹ thuật - Công nghệ >

Functional and structural properties of molecular soy protein fractions

Functional and structural properties of molecular soy protein fractions

Functional and structural properties of molecular soy protein fractions

... nutritional and functional properties of the major protein fraction was mapped out Finally, the functional and structural properties of the 11S and 7S were contrasted with those of the 2S fraction of soy ... extraction of 11S caused the 11S to have higher level of isoflavone, better foaming properties and formed harder gels I The functional and structural properties of 2S soy protein in relation to other molecular ... foaming and emulsifying properties of the protein system The chapter of the study involved the study of the foaming and emulsifying properties of 2S soy protein in relation to other molecular protein...
  • 170
  • 308
  • 0
Tài liệu Báo cáo khoa học: Functional and structural analyses of N-acylsulfonamidelinked dinucleoside inhibitors of RNase A ppt

Tài liệu Báo cáo khoa học: Functional and structural analyses of N-acylsulfonamidelinked dinucleoside inhibitors of RNase A ppt

... N-acylsulfonamide-linked dinucleoside inhibitors of RNase A [1], and has numerous interesting homologs [24] In humans, angiogenin (RNase 5) is an inducer of neovascularization, and plays an ... Journal 278 (2011) 541549 ê 2011 The Authors Journal compilation ê 2011 FEBS N Thiyagarajan et al A B C D N-acylsulfonamide-linked dinucleoside inhibitors of RNase A upon binding to RNase A, and ... inspection shows that the relevant subsite of RNase A has a negative potential and hence cannot accommodate an electronegative atom In contrast, the exocyclic N6-amino group of adenine forms a hydrogen...
  • 9
  • 626
  • 0
Báo cáo khoa học: Functional and structural characterization of novel mutations and genotype–phenotype correlation in 51 phenylalanine hydroxylase deficient families from Southern Italy docx

Báo cáo khoa học: Functional and structural characterization of novel mutations and genotype–phenotype correlation in 51 phenylalanine hydroxylase deficient families from Southern Italy docx

... analysis of the PAH gene in 51 unrelated HPA patients from Southern Italy In addition to the molecular epidemiology of PAH mutations, we characterized the functional properties of two novel mutations ... phenylalanine hydroxylase deciency in Southern Italy: a 96% detection rate with ten novel mutations Ann Hum Genet 71, 1 8519 3 10 Waters PJ (2003) How PAH gene mutations cause hyper-phenylalaninemia and ... analysis of novel mutations Among the mutations identied in our HPA population, two (i.e p.Q301P and c.707-2delA) were novel One of these mutations, p.Q301P, arises from the c.911A>C transversion in...
  • 12
  • 491
  • 0
Báo cáo khoa học: Correlation between functional and structural changes of reduced and oxidized trout hemoglobins I and IV at different pHs doc

Báo cáo khoa học: Correlation between functional and structural changes of reduced and oxidized trout hemoglobins I and IV at different pHs doc

... order: iron(II)HbIV > met-HbIV > met-HbI > iron(II)-HbI The larger peroxidative activity of iron(II)-HbIV with respect to metHbIV is in line with previous data obtained with human HbA derivatives [7] ... [6] Figure shows the peroxidase activity of iron(II)- and met-forms of HbI and HbIV It is evident that the enzymatic activity decreases according to the order iron(II)-HbIV > met-HbIV > met-HbI ... indicating that tetramers with high-spin ligand water of iron(III) subunits, show the most T-state behavior [38] CD spectra show that iron(II)- and iron(III)-HbI structural features are almost insensitive...
  • 9
  • 368
  • 0
Báo cáo Y học: Azidothymidine causes functional and structural destruction of mitochondria, glutathione deficiency and HIV-1 promoter sensitization pptx

Báo cáo Y học: Azidothymidine causes functional and structural destruction of mitochondria, glutathione deficiency and HIV-1 promoter sensitization pptx

... mouse liver: synergism by glutathione depletion and protection by N-acetylcysteine Biochem J 304, 477–483 14 Anderson, M.E (1989) Enzymatic and chemical methods for the determination of glutathione: ... day 15 Similarly, the band shift efficiency in the H2O2-cultures increased by 6.7-fold of the control in 15 days and reached the plateau of 10.7-fold activation on day 20 (Fig 4A) Presence of ... Fauci, A.S (1991) Suppression of human immuno deficiency virus expression in chronically infected monocytic cells by glutathione, gluthathione ester, and N-acetylcysteine Proc Natl Acad Sci USA...
  • 7
  • 378
  • 0
Báo cáo khoa học: Phosphatidylserine induces functional and structural alterations of the membrane-associated pleckstrin homology domain of phospholipase C-d1 docx

Báo cáo khoa học: Phosphatidylserine induces functional and structural alterations of the membrane-associated pleckstrin homology domain of phospholipase C-d1 docx

... properties of PLC-d1 and the PLC isoforms at the membrane-associated state through the PS-dependent structural and functional alterations of the PH domains Although the a2-helix located in the b5 ... abolishes these conformational changes of the PH domain and induces the formation of a structure similar to that of the PH domain bound to IP3 The proposed structures of the PLC-d1 PH domain are ... from the ratios of the PH domain partitioned into the supernatants and the precipitates corresponding to the free PH domain and PH domain PIP2 complex, respectively Affinities of the PLC-d1 PH domain...
  • 11
  • 425
  • 0
Functional and structural study of singapore grouper iridovirus ORF086R

Functional and structural study of singapore grouper iridovirus ORF086R

... FUNCTIONAL AND STRUCTURAL STUDY OF SINGAPORE GROUPER IRIDOVIRUS ORF086R YAN BO (B.Sc., Xiamen University,China) A Thesis Submitted For The Degree Of Master Of Science Department of Biological ... -55 Figure3.20 CD study of ORF086R( 1-85) 57 Figure3.21 DLS study of ORF086R( 1-85) 57 Figure3.22 1D NMR study of ORF086R ... process of mature virus Due to the availability of cell line, we have decided to take a functional and structural study of SGIV The objectives of this project are: 1) To discover the functions of...
  • 89
  • 179
  • 0
Báo cáo khoa học: Purification and structural analysis of the novel glycoprotein allergen Cyn d 24, a pathogenesis-related protein PR-1, from Bermuda grass pollen pot

Báo cáo khoa học: Purification and structural analysis of the novel glycoprotein allergen Cyn d 24, a pathogenesis-related protein PR-1, from Bermuda grass pollen pot

... we have purified, cloned and characterized Cyn d 24 as a novel pathogenesis-related protein from BGP Additionally, the identification of Cyn d 24 has identified the involvement of a novel class of ... AGAD AADA.NA.VG D. D 113 Zea AYA.S A- QRQG LI GG FW AGAD.SASDA.GS.VS QY.DHDT.S 112 Nicotiana AYA.N S-Q.AA NL HGQ AE -GDFMTAAKA.EM.V QY.DHD 118 Cyn d 24 DQGKMCGHYTAVVWKDTTSVGCGRVLCDDKKDTMIMCSYWPPGNYENQKPY ... Cloning and sequencing of cDNA encoding Cyn d 24 Cyn d 24-specific cDNA was obtained by cDNA synthesis and PCR amplification from total RNA isolated from BGP A sense primer, designed on the basis of...
  • 10
  • 665
  • 0
Báo cáo khóa học: Structural properties of the protein SV-IV potx

Báo cáo khóa học: Structural properties of the protein SV-IV potx

... a-helix in the whole protein, and the 1–70 region is poorly structured SDS increases the a-helix content of proteins revealing the helical potential The a-helix content of the monomeric form of SV-IV ... acetylation at one of the three residues, because the signal of the triacetylated species was less intense than that of the diacetylated species The MS/MS Ó FEBS 2003 Structural properties of SV-IV (Eur ... the total number of charges measured by electrospray MS Theoretical mass is the mass calculated on the basis of the protein amino-acid sequence The relative abundance refers to the ratio of the...
  • 9
  • 416
  • 0
Báo cáo khoa học: Purification and structural study of the b form of human cAMP-dependent protein kinase inhibitor pdf

Báo cáo khoa học: Purification and structural study of the b form of human cAMP-dependent protein kinase inhibitor pdf

... regulation of < /b> the < /b> PKI and < /b> PKI isoforms of < /b> the < /b> inhibitor protein of < /b> the < /b> cAMP-dependent protein kinase J Biol Chem 272, 20011–20020 Byler, D.M & Susi, H (1986) Examination of < /b> the < /b> secondary structure of < /b> proteins ... spectrum of < /b> human PKIb in H2O The < /b> quantitative contributions of < /b> the < /b> individual amide I¢ component bands, determined by band fitting of < /b> the < /b> absorbance spectrum of < /b> Fig 4A, are shown in Fig and < /b> Table ... exhibits five well defined Ó FEBS 2004 Purification < /b> and < /b> structural < /b> study < /b> of < /b> human PKIb (Eur J Biochem 271) 1771 Fig Activity analysis of < /b> inhibition of < /b> cAMP-dependent protein kinase activity by inhibitor...
  • 6
  • 531
  • 0
Effects of simultaneous doping with boron and phosphorous on the structural, electronic and optical properties of silicon nanostructures

Effects of simultaneous doping with boron and phosphorous on the structural, electronic and optical properties of silicon nanostructures

... asymptotically the value of the band-gap of the undoped Si-nw This is another indication of how doping can modify the electronic and optical properties of the Si nanostructures Conclusions 3.2 3.4 ... systematic analysis of the effect of the B and P codoping in Si-nw, concentrating not only on the structural properties but also on how doping influences the electronic and optical properties Here, ... concentrate on the dependence of the doped Si-nw properties on the dopant concentration, we note first that on augmenting the number of atoms in the cell (thus lowering the dopant concentration),...
  • 8
  • 1,024
  • 0
structural and electrochromic properties of tungsten oxide prepared by surfactant-assisted process

structural and electrochromic properties of tungsten oxide prepared by surfactant-assisted process

... of microstructural and electrochromic properties of the nanostructured tungsten oxides with mesopores from the TMDD surfactantassisted process The crystallization status, surface morphology and ... surfactant was used as a structural- directed template, mesoporous tungsten oxide was obtained by the modified sol–gel route The microstructural properties of the as -prepared tungsten oxides thin films ... Spectroelectrochemical and monochromatic Fig Survey scan XPS spectra (a) and W 4f high-resolution XPS spectra (b) for tungsten oxide films of sample A, sample C and sample D, and O 1s level peak analysis of sample...
  • 7
  • 630
  • 0
structural and photocatalytic properties of iron- and europium-doped tio2

structural and photocatalytic properties of iron- and europium-doped tio2

... (2008) 146–153 Fig TEM images of undoped TiO2 (a), Eu-doped TiO2 (b) and Fe- and Eu-doped TiO2 (c) inant for undoped and Fe-doped TiO2 samples (Fig 2a) In Eu-doped TiO2 many elongated particles ... that of TiO2 , suggesting similar Fe and Ti surroundings in the doped and undoped samples In order to verify this statement, the filtered EXAFS of L Diamandescu et al / Materials Chemistry and ... Conclusions Iron- and europium-doped TiO2 nanoparticles were obtained by a hydrothermal route, at mild temperature and pressure (∼200 ◦ C and ∼15 atm, for h) Rietveld refinements of the XRD patterns...
  • 8
  • 410
  • 0
PREDICTION OF CHEMICAL REACTIVITY PARAMETERS AND PHYSICAL PROPERTIES OF ORGANIC COMPOUNDS FROM MOLECULAR STRUCTURE USING SPARC pptx

PREDICTION OF CHEMICAL REACTIVITY PARAMETERS AND PHYSICAL PROPERTIES OF ORGANIC COMPOUNDS FROM MOLECULAR STRUCTURE USING SPARC pptx

... estimate physical properties and chemical reactivity parameters of organic compounds strictly from molecular structure SPARC uses computational algorithms based on fundamental chemical structure ... chemical and physical properties to Program Offices (e.g., Office of Water, Office of Solid Waste and Emergency Response, Office of Prevention, Pesticides and Toxic Substances) and Regional Offices ... number of chemical reactivity parameters and physical properties for a wide range of organic molecules strictly from molecular structure This prototype computer program called SPARC (SPARC Performs...
  • 158
  • 631
  • 0

Xem thêm

Từ khóa: 04 optical magnetic and structural properties of semiconductor and semimagnetic nanocrystalsthe basic molecular and structural components of silicate clays a single tetrahedron and single octahedron b thousands of tetrahedrons and octahedrons are connected to give planes of silicon and aluminum or magnesium ions univethe role of remote sensing in deciphering functional and structural diversitystructural and dielectric properties of glass ceramic substrate with varied sintering temperat5 equal loss of functional and visual properties in some living things deficitsphoto control of the structural and optical properties of4—physical and mechanical properties of structural lightweightaggregate concretefunctional and bioinformatic analysis of cloned maize c4 and arabidopsis c4 like ppdk regulatory proteina nitrogen sorption isotherms b corresponding pore size distribution curves and c structural and textual properties of a mc 600 b ionp mc 600 c ionp mc 450 and d ionp pchygric thermal and durability properties of autoclaved aerated concretestrength and deformation properties of solidsadhesion and cohesion properties of solids adsorption to solidsexistence uniqueness stability and differentiability properties of the flow associated to weakly differentiable vector fieldsdefinition and basic properties of equivalence relationsborel serre compactification of locally symmetric spaces and cohomological properties of arithmetic groupsBáo cáo quy trình mua hàng CT CP Công Nghệ NPVchuyên đề điện xoay chiều theo dạngNghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt namđề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giảiGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitNGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN SLIDEPhát triển du lịch bền vững trên cơ sở bảo vệ môi trường tự nhiên vịnh hạ longPhát hiện xâm nhập dựa trên thuật toán k meansNghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000Tìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tinKiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)BT Tieng anh 6 UNIT 2Tranh tụng tại phiên tòa hình sự sơ thẩm theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn xét xử của các Tòa án quân sự Quân khu (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtNguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vậtTrách nhiệm của người sử dụng lao động đối với lao động nữ theo pháp luật lao động Việt Nam từ thực tiễn các khu công nghiệp tại thành phố Hồ Chí Minh (Luận văn thạc sĩ)