Molecular characterization and developmental analysis of the TGF beta 3 gene in zebrafish

... mutants, trunk notochords are present. This shows that spt mutation can suppress the 35 Molecular characterization and developmental analysis of the TGF Beta 3 gene in zebrafish flh mutation, suggesting that in the midline, flh is involved in promoting ... Molecular characterization and developmental analysis of the TGF Beta 3 gene in zebrafish phosphorylating TβRI on the serine and threonine residues and thus results in the activation of TβRI. In addition, the TβRII kinase domain can also phosphorylate itself. ... the molecule to the membrane of the early endosomes. The efficient recruitment of the 9 Molecular characterization and developmental analysis of the TGF Beta 3 gene in zebrafish Smad 2 and Smad 3 to the activated receptors for phosphorylation is facilitated by these ...

Báo cáo khoa học: " Molecular characterization and phylogenetic analysis of the complete genome of a porcine sapovirus from Chinese swine" pdf

... GTCCACATCAACGGCCGCCGGCTCG AGCCAACAGACACTCCTGTGTTCC CATGCCAGACCCTGATATTATCACC ACCTACACCAATGTCACCTGGAC GTGCCACACCTACTATGACCACAG TCAAGCCTCCAAACCAAGCC TGGCGGTCCATAAATGAGGTG TATGCAGCTTTGGCAATTCCC TTGATCTTTAGCAACTGTATCTG ... TGGTGGAGGCCTGTTCAGAGC CCAAGTTGTGGGCTGTCAACAC CAGAGTCCTCCTGGTGGACATTC ATTACCAAGCGCAACGCTAGGC CATGTGGCCAACATGTGTG TGATTTGGTCAAGGTAGCC CCTTCTACAACACCAAATGATTGCC AGGCCAGGATGTCAACACTGGCAC ATGTATGGATAGCCCTCAGATTG ... Decaro N, Corrente M, Elia G, Cavalli A, Radogna A, Costantini V, Saif LJ, Lavazza A, Di Trani L, Buonavoglia C, Cavalli A, Radogna A, Costantini V, Saif LJ, Lavazza A, Di Trani L, Buonavoglia...

Molecular characterization and developmental analysis of interferon regulatory factor 6 (IRF6) gene in zebrafish

... mouse, Fugu, and zebrafish 63 -64 3.5 Assembled sequences of irf6 genomic fragments 64 -66 3 .6 The irf6 gene locus on the LG22 in T51 RH panel and in the Ensembl zebrafish version (ZV6) 68 -69 3.7 Whole-mount ... morpholinos 85 3.14 Loss of irf6 function phenotypes 86- 87 3.15 Comparison of expression of molecular markers in irf6 morphants and wildtype 91-92 3. 16 Hematoxylin and eosin staining of intestines ... MOLECULAR CHARACTERIZATION AND DEVELOPMENTAL ANALYSIS OF INTERFERON REGULATORY FACTOR (IRF6) GENE IN ZEBRAFISH BEN JIN (M.Sc., National University of Singapore) A THESIS SUBMITTED...

Báo cáo khoa học: Characterization and expression analysis of the aspartic protease gene family of Cynara cardunculus L. docx

... pattern of expression of a gene [34–39] To evaluate the relevance of the leader intron in cardosin expression, we deleted it from the 5¢-ﬂanking region of the genes (Fig 8) The deletion of the cardosin ... region of the cardosin B gene (from ) 147 bp to + 238 bp) .The 529 bp of the promoter region of the cardosin A gene that is relevant for gene expression in Arabidopsis and the corresponding region of ... of cardosin A, B and D genomic clones with the respective cDNAs (Fig 2) revealed the presence of an intron in the 5¢-UTR of the genes The nucleotide sequences of the cDNA and genomic clones of...

Báo cáo y học: " Complete coding sequence characterization and comparative analysis of the putati" docx

... drafted the manuscript SP and KS participated in the sequence alignment PL and YP participated in the design of the study and performed the data statistical analysis YP conceived of the study in ... only 64% sequence identity with the other HRV-Cs HRV-CU072 coding sequence analysis To investigate the molecular characteristics of the putative new HRV-C strain, we performed comparative analysis ... compatibility matrix (PCM) analysis is a computational method used to investigate the phylogenetic relationship of the sequences to be analyzed The PCM plot of nucleotide sequence alignment in intraand...

Báo cáo y học: " Assessment and histological analysis of the IPRL technique for sequential in situ liver biopsy" ppsx

... Scott Lindsay from Veterinary Pathology Diagnostic Services, Faculty of Veterinary Science, University of Sydney, for assistance in interpretation of histology results The authors acknowledge the ... Page of extending between portal triads The sparsity of these septal branches in the rat makes the concept of the acinus unlikely in this species Although the vasculature necessary to define the ... present The cytoplasm of most hepatocytes is pale and eosinophilic with finely granular basophilic inclusions The hepatic sinusoids and central veins are predominantly clear of erythrocytes Fifteen...

Molecular characterization and developmental expression patterns of the zebrafish twist gene family

... pattern with other species 83 4.5.1 Zebrafish twist1 a and twist1 b genes 83 4.5.2 Zebrafish twist2 85 4.5.3 Zebrafish twist3 86 4.6 Shared and unique expression sites of the zebrafish twist genes 86 ... proteins generated by the neighbor-joining method Figure 3.6: Gene structure of twist1 a, twist1 b, twist2 and twist3 Figure 3.7: RT-PCR of zebrafish twist genes Figure 3.8: Expression of zebrafish twist ... medaka, and human twist genes showed that the zebrafish twist1 a and twist1 b are coparalogs and co-orthologs of human TWIST1 Furthermore, zebrafish twist1 a and twist1 b are orthologous to medaka twist1 a...

Tài liệu Báo cáo khoa học: Cloning, characterization and expression analysis of interleukin-10 from the common carp, Cyprinus carpio L. docx

... to their positions The arrowheads depict the residues important for the structural core of the IL-10 gene The underlined amino acid residues are the signal sequences of the respective genes The ... conclusion, the IL-10 gene from carp has been isolated and its genomic structure and expression analysis investigated This work will pave the way for further investigation of the biological function of ... Fig Hydropathy plot of putative IL-10 proteins from carp, torafugu and human The x-axis denotes the residue position and the y-axis represents hydrophobicity The hydrophobicity analysis was carried...

Tài liệu Báo cáo Y học: Puriﬁcation, characterization, immunolocalization and structural analysis of the abundant cytoplasmic b-amylase from Calystegia sepium (hedge bindweed) rhizomes ppt

... b-amylase (Cys83, Cys96, Cys209 and Cys344) are homologous to those found in soybean b-amylase (Cys82, Cys97, Cys208 and Cys343) On the analogy of the soybean b-amylase, the active site of the ... for the b-amylase from C sepium using the X-ray coordinates of the soybean b-amylase (Fig 4) According to the Ramachandran plot of this model the f and c angles of most of the residues are in the ... Inhibition of the enzyme activity by glucose, maltose and cyclohexaamylose For the study of the enzyme inhibition by glucose, maltose and cyclohexaamylose b-amylase activity was measured using the iodine...

Báo cáo khoa học: Isolation, characterization and expression analysis of a hypoxia-responsive glucose transporter gene from the grass carp, Ctenopharyngodon idellus potx

... 5¢-CCTGATCGACGCACGAGT-3¢ and GT1-R, 5¢-TTTTGCAAGTCATAGTAATCAGTTT-3¢ for GTcDNA1 (2150 bp); and GT2-F, 5¢-CACCAGCAACTAC CTGATCGA-3¢ and GT2-R, 5¢-CACAAAATATGCTT CCAAGTGC-3¢ for GT-cDNA2 (3043 bp) RNA isolation and ... revealed two putative polyadenylation (ATTAAA) signals: one is located 18 bp upstream from the poly (A) of GT-cDNA1 and another is located 11 bp upstream from the poly (A) of GT-cDNA2 (data not ... 5¢-RACE and the two alternate 3¢-ends of exon 12 were deduced by 3¢-RACE, and are delineated by the full-length cDNA clones, GT-cDNA1 and GT-cDNA The two putative polyadenylation sites (ATTAAA) are...

báo cáo khoa học: " Characterization and structural analysis of wild type and a non-abscission mutant at the development funiculus (Def) locus in Pisum sativum L" pdf

... and attachment of pea seeds to the replum in a pod of the def mutant pea The def mutant pea shows a swollen and thick funicle compared to the wild type Arrows indicate the AZ and ALZ in the wild ... growing of the plants, harvested materials, carried out the structural examination and drafted the manuscript YKL participated in designing the experiments, structural analysis and the drafting of the ... pea seed at stage 8.1 and (B) In mature pea seed at 2.1 (C) Higher magnification of the AZ development in the young pea seed in (A) (D) Higher magnification of the AZ in the mature pea seed in...

Comparing the cultural and linguistic analysis of the English word “meal” and words relating to it in contrast with Vietnamese equivalents.

... of word meal in English and words relating to it (in contrast with Vietnamese equivalents) - Definition of word meal - Field of word meal in English and in Vietnamese equivalents - Cultural and ... with the notion of meal are called field of word meal In our opinion, field of word meal is all the words relating to it mainly including eating and drinking They are parts of the word meal and ... _ Compare the cultural and linguistic analysis of the English word meal and words relating to it in contrast with Vietnamese equivalents Scope of the study Because of space and time, the graduation...

54
1,037
1

Tài liệu Static and Dynamic Analysis of the Internet’s Susceptibility to Faults and Attacks docx

... 0.1 (10% attacks) We analyze both static and dynamic susceptibility of the Internet to faults and attacks In static analysis, we first reconfirm previous work of Albert et al [5] Based on these results, ... of the Internet’s susceptibility to attacks and faults, and discovered two interesting results; First, the Internet is much more preferential than the BA model, and its susceptibility under attacks ... snapshots of the real Internet topology.1 On the other hand, [42], [43] have shown that the clustering coefficient of the Internet has been growing and that the average diameter of the Internet...

Tài liệu Báo cáo khoa học: Molecular characterization and allergenic activity of Lyc e 2 (b-fructofuranosidase), a glycosylated allergen of tomato pdf

... The histamine releases were measured by an enzyme immunoassay (Immunotech) After subtraction of the spontaneous release of the basophils, the allergeninduced histamine release was calculated as ... self-prepared tomato extract, nLyc e 2, rLyc e 2, horseradish peroxidase, deglycosylated horseradish peroxidase, the glycopeptide MUXF and MUXF conjugated to BSA as well as BSA alone were used ... SDS/PAGE analysis of electroeluted recombinant Lyc e isoforms rLyc e 2. 01 (lane 1) and rLyc e 2. 02 (lane 2) , Coomassie stain M, molecular mass marker reacted with the recombinant protein in the ELISA,...

Báo cáo khoa học: Puriﬁcation and structural analysis of the novel glycoprotein allergen Cyn d 24, a pathogenesis-related protein PR-1, from Bermuda grass pollen pot

... we have purified, cloned and characterized Cyn d 24 as a novel pathogenesis-related protein from BGP Additionally, the identification of Cyn d 24 has identified the involvement of a novel class of ... AGAD AADA.NA.VG D. D 113 Zea AYA.S A- QRQG LI GG FW AGAD.SASDA.GS.VS QY.DHDT.S 112 Nicotiana AYA.N S-Q.AA NL HGQ AE -GDFMTAAKA.EM.V QY.DHD 118 Cyn d 24 DQGKMCGHYTAVVWKDTTSVGCGRVLCDDKKDTMIMCSYWPPGNYENQKPY ... Cloning and sequencing of cDNA encoding Cyn d 24 Cyn d 24-specific cDNA was obtained by cDNA synthesis and PCR amplification from total RNA isolated from BGP A sense primer, designed on the basis of...

Xem thêm

Từ khóa: hunting fishing and trapping analysis of the animal data molecular cellular and developmental biology of breast cancer anatomy histology embryology and developmental anomalies of the esophagus anatomy histology embryology and developmental anomalies of the stomach and duodenum anatomy histology embryology and developmental anomalies of the pancreass anatomy histology embryology and developmental anomalies of the liver evaluate uncertainty and sensitivity analysis of the relative rankings and intra host strains conservation and variability analysis of the influenza segments cloning prokaryotic expression and antigenicity analysis of the recombinant protein construction characterization and end sequencing of the sheep bac library morphological morphometric and histochemical analysis of the large intestine of rabbits intoxicated with solanum glaucophyllum duraznillo blanco a contrastive analysis of the metaphor anger is heat in english and the possible equivalent expressions in vietnamese analysis of the company apos s facts in recent years cloning characterization expression analysis and chromosomal localization of the gene coding for the porcine αiib subunit of the αiibβ3 integrin platelet receptor give a critical analysis of the concept of self defence in public international law and international humanitarian law Báo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018 Báo cáo quy trình mua hàng CT CP Công Nghệ NPV đề thi thử THPTQG 2019 toán THPT chuyên thái bình lần 2 có lời giải Biện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọ Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Phát hiện xâm nhập dựa trên thuật toán k means Định tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)Tìm hiểu công cụ đánh giá hệ thống đảm bảo an toàn hệ thống thông tin Thơ nôm tứ tuyệt trào phúng hồ xuân hương Sở hữu ruộng đất và kinh tế nông nghiệp châu ôn (lạng sơn) nửa đầu thế kỷ XIX Tổ chức và hoạt động của Phòng Tư pháp từ thực tiễn tỉnh Phú Thọ (Luận văn thạc sĩ)Kiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vật Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật BÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘI Chiến lược marketing tại ngân hàng Agribank chi nhánh Sài Gòn từ 2013-2015 Đổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt nam