Báo cáo khoa học: A novel, promoter-based, target-speciﬁc assay identiﬁes 2-deoxy-D-glucose as an inhibitor of globotriaosylceramide biosynthesis docx

Báo cáo khoa học: A novel metallobridged bis(b-cyclodextrin)s ﬂuorescent probe for the determination of glutathione doc

... processes such as transport,protein synthesis, catabolism and metabolism [1]. Itcan also protect cells against reactive oxygen speciesand help them maintain an adequate intracellularredox status [2]. ... solution wasmeasured at 365 ⁄ 480 nm.The GSH content of the plasma was derived fromthe standard curve and the regression equation. Theaverage recovery test was made using the standardaddition ... detection. Talanta 65,986–990.9 Svardal AM, Mansoor MA & Ueland PM (1990)Determination of reduced, oxidized, and protein-boundglutathione in human plasma with precolumn derivati-zation with...

Báo cáo khoa học: A novel, promoter-based, target-speciﬁc assay identiﬁes 2-deoxy-D-glucose as an inhibitor of globotriaosylceramide biosynthesis docx

... Furukawa2and Ken-ichi Nakayama11 Glycolipids Function Analysis Team, Health Technology Research Center, National Institute of Advanced Industrial Science and Technology,Kagawa, Japan2 Department ... synthase gene; Gb4, globotetraosylceramide (GalNAcb1,3Gala1,4LacCer); GD 1a, NeuAca2,3Galb1,3GalNAcb1,4(NeuAca2,3)LacCer; GD1b, Galb1,3GalNAcb1,4(NeuAca2,8NeuAca2,3)LacCer; GM1, Galb1,3GalNAcb1,4(NeuAca2,3)LacCer; ... 2009 The Authors Journal compilation ª 2009 FEBS A novel, promoter-based, target-speciﬁc assay identiﬁes 2-deoxy-D-glucose as an inhibitor of globotriaosylceramide biosynthesis Tetsuya Okuda1,...

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... 277 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... purchased from Toyobo (Osaka, Japan). Emul-gen 911 was a gift from Kao Chemical (Tokyo, Japan).NADPH, NADH and NADP+were purchased fromOriental Yeast (Tokyo, Japan). a- Cyano-4-hydroxycinnamicacid ... Fujiwara and Susumu ImaokaNanobiotechnology Research Center and Department of Bioscience, School of Science and Technology, Kwansei Gakuin University,Gakuen, Sanda, JapanCytochrome P450s are associated...

Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx

... (sense) and5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primersfor unmethylated DNA were: 5¢-GAAGTAGGTGGAGTATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCTACTT-3¢ (antisense).Caspase 3 activityCells ... caspase assay were seeded on a 24-well plate and transfected with FuGENE 6. The caspase assay was performed using the CaspACE colorimetric assay kit as described by the manufacturer (Promega). ... intensity was determined using imagemaster2d elite software 4.01 (Amersham Bioscience, Uppsala,Sweden).Statistical analysisData in bar graphs are expressed as the mean and standarddeviation of three...

Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt

... tachykinins: a review. Zool Sci 5,533–549.7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy-ama M, Minakata H, Chiba T, Metoki H, Satou Y &Satoh N (2004) Tachykinin and tachykinin receptor of an ascidian, ... vulgaris).Biochem J 387, 85–91.25 Kanda A, Takahashi T, Satake H & Minakata H (2006)Molecular and functional characterization of a novelgonadotropin-releasing-hormone receptor isolated ... Winther AM, Nachman RJ,Taylor CA, Shirras AD, Coates D, Isaac RE & NasselDR (2000) Expression and functional characterization of a Drosophila neuropeptide precursor with homologyto mammalian...

Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt

... experi-ment carried out without the mimic, ascorbate, and ferroussulfate was known as the control group.Biological analysis of mimics againstmitochondrial damageMitochondrial swelling was assayed as ... swelling and a decrease in mitochondria integrity.TBARS content in ferrous sulfate ⁄ ascorbate-treatedmitochondria was analyzed by thiobarbituric acid assay [34]. In this assay, thiobarbituric acid ... thiobarbituric acid reactivesubstances (TBARS) as a marker for lipid per-oxidation, and 6-CySeCD, 6-SeCD and Ebselen as antioxidants in ferrous sulfate ⁄ ascorbate-induced mito-chondrial damage...

Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt

... Gram-negative bacteria, and their adaptability tomany different pollutants [1].Pseudomonas stutzeri OX1 is a Gram-negative bacteriumisolated from the activated sludge of a wastewater treatmentplant, ... & Brade, H. (1994) Preparationand structural analysis of oligosaccharide monophosphatesobtained from the lipopolysaccharide of recombinant strains of Salmonella minnesota and Escherichia coli ... Scognamiglio, R., Viggiani, A. , Izzo, V., Passaro, I.,Notomista, E., Piaz, F.D., Amoresano, A. , Casbarra, A. , Pucci, P.& Di Donato, A. (2002) Expression and puriﬁcation of therecombinant...

Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc

... NADPH, and glutamate dehydrogenasewere from Wako Pure Chemicals (Osaka, Japan); meatextract (Extract Ehlrich) w as from Kyokuto Seiyaku Kogyo(Osaka, Japan); and pentaﬂuorophenylhydrazine was ... only as a carbon source, but also as a nitrogensource for g rowth of the assimilating bacteria. Deaminases,which catalyze the release of ammonia, are a key enzyme inthe metabolic pathways of ... Decarboxylation has a concertedmechanism with an aromatic t ransition state. 2-hydroxy-5-carboxymuconic 6 -semialdehyde has an aldehyde groupand a C-5 carboxyl group, which is a 3-ketoacid. As...

Tài liệu Báo cáo khoa học: A novel c-N-methylaminobutyrate demethylating oxidase involved in catabolism of the tobacco alkaloid nicotine by Arthrobacter nicotinovorans pAO1 ppt

... thebiodegradation of a n a lmost unlimited spectrum of naturaland man-made organic compounds, among them thetobacco alkaloid nicotine. Perhaps analysed in greatestdetail is the pathway of nicotine ... Optitran BA-S 85; Schleicher &Schuell, Dassel, Germany). The membranes were decoratedwith MABO antiserum and developed by using alkalinephosphatase-conjugated anti-rabbit IgG (Sigma) and ... pair 5¢-GACCTGAGTAGAAATGGATCCCTGA TGGACAGG-3¢and 5¢-GGAATGGCTCGAGGGATCATCACC-3¢ bear-ing the restriction e nzyme recognition sites Bam HI andXhoI, respectively. pAO1 DNA, isolated as describedpreviously...

Tài liệu Báo cáo khoa học: "A Novel Feature-based Approach to Chinese Entity Relation Extraction" ppt

... reasonable to conclude that kernel-based especially tree-kernel approaches are not suitable for Chinese, at least at current stage. In this paper, we study a feature-based approach that basically ... relation extraction has been extensively studied in English over the past years. It is typically cast as a classification problem. Existing approaches include feature-based and kernel-based ... phrase chunking information and semi-automatically collected country name list and personal relative trigger word list. Jiang and Zhai (2007) then systematically explored a large space of...

Xem thêm