Báo cáo khoa học: Spermosin, a trypsin-like protease from ascidian sperm cDNA cloning, protein structures and functional analysis doc

... Spermosin, a trypsin-like protease from ascidian sperm cDNA cloning, protein structures and functional analysis Eri Kodama1, Tadashi Baba2, Nobuhisa Kohno2, Sayaka Satoh2, Hideyoshi ... fertilization experiments are more a ccessible thanthose in mammals, and large amounts of s perm and egg areobtainable from thousands of these animals which arecultivated in Onagawa Bay for human ... [17].Homology between ascidian spermosin and humanacrosin, and that between ascidian spermosin and ascidian acrosin were 27% in both cases. In contrast with acrosin,spermosin did not have a consensus...

Tài liệu Báo cáo khoa học: Interferon-a induces sensitization of cells to inhibition of protein synthesis by tumour necrosis factor-related apoptosis-inducing ligand ppt

... Shigeno M, Nako K, Ichikawa T, Suzuki K, Kawakami A, Abiru S, Miyazoe S, Nakagawa Y, Ishikawa H,Hamasaki K et al. (2003) Interferon -a sensitizes humanhepatoma cells to TRAIL-induced apoptosis ... 40760–40767.34 Yamada H, Tada-Oikawa S, Uchida A & Kawanishi S(1999) TRAIL causes cleavage of bid by caspase-8 and loss of mitochondrial membrane potential resulting inapoptosis in BJAB cells. ... Monoclonal antibody against PARP (C2-10)was obtained from Trevigen (Gaithersburg, MD, USA).Antibodies against 4E-BP1 and a- tubulin were obtained from Santa Cruz Biotechnology (Santa Cruz, CA, USA)and...

Báo cáo khoa học: Benzo[a]pyrene impairs b-adrenergic stimulation of adipose tissue lipolysis and causes weight gain in mice A novel molecular mechanism of toxicity for a common food pollutant doc

... unlike b-adrenergic and ACTH receptorsthat contain seven transmembrane spanning domains,the ANP receptor (NPR -A) is a guanyl cyclase thatcontains only a single transmembrane spanningdomain [27].We ... Body weight and food intakeof animals housed in pairs were measureddaily at 09.00, i.e. immediately after the darkcycle. (C) and (D) show the average weightgain ± SEM and the average food consump-tion ... accumulation offat mass remains to be determined.Available epidemiological data addressing the impli-cation of PAH, in general, as a causal factor in thepathogeny of metabolic disorders are currently...

Tài liệu Báo cáo khoa học: Roles of AP-2 transcription factors in the regulation of cartilage and skeletal development doc

... RRHEDLLHGP-HA Beta HPWGQRQRQEVGSEAGSLLPQPRAALPQLSG-LDP RRDYHSVRRPDVLLHSAHHG Gamma QQAWPGRQSQEGAGLPSHHGRPAGLLPHLSG-LEAGAVSARRDAY RRSDLLLPHAHAL Epsilon QAAWAAPRAAARAHEE PPGLLAPPARALG-LDP RRDYA TAVPRLLHGLADG ... was shownthat the broad-complex, tramtrack and bric -a- bracdomain containing protein KCTD1 directly binds toAP- 2a and acts as a negative regulator for AP- 2a trans-activation [34]. It was also ... Analyses ofAP- 2a- null mice have demonstrated that AP- 2a is a fundamental regulator of mammalian craniofacialdevelopment. AP- 2a knockout mice die perinatallywith craniofacial defects, thoracoabdominoschisis,...

Tài liệu Báo cáo khoa học: Multidentate pyridinones inhibit the metabolism of nontransferrin-bound iron by hepatocytes and hepatoma cells docx

... and novel tetradentate and hexadentate analogues on NTBI uptake and mobilization from rat hepatocytes and hepatoma cells. DFO wasincluded as a reference chelator.Materials and methodsAnimalsHepatocytes ... methylamine was from BDH Chemicals,Australia. All other chemicals were of analytical reagentquality and purchased from Sigma or Ajax (Sydney,Australia).ChelatorsDFO was purchased from Sigma ... Acta 1269, 105–114.38. Agarwal, M.B., Gupte, S.S., Viswanathan, C., Vasandani, D.,Ramanathan, J., Desai, N., Puniyani, R.R. & Chablani, A. T.(1992) Long-term assessment of eﬃcacy and safety...

Báo cáo khoa học: Plant oxylipins: role of jasmonic acid during programmed cell death, defence and leaf senescence doc

... GENEVESTIGATOR. Arabidop-sis microarray database and analysis toolbox. PlantPhysiol 136, 2621–2632.165 Tsuchiya T, Ohta H, Okawa K, Iwamatsu A, Shi-mada H, Masuda T & Takamiya K-I (1999) ... contributes to OPDA and JA synthesis [34]. Bycontrast, fractions of the unsaturated membrane fattyacid a- linolenic acid and a- linoleic acid are convertedrandomly and nonenzymatically to a variety of ... kinases, calledSARK and SIRK, respectively [125]. SARK and SIRKshare similar structures and consist of an extracellularleucine-rich domain, a transmembrane domain, and a Ser ⁄ Thr kinase domain....

Báo cáo khoa học: pyr RNA binding to the Bacillus caldolyticus PyrR attenuation protein – characterization and regulation by uridine and guanosine nucleotides potx

... native and the G72 3A and G72 6A sequence variants of BcBL2 indicate that theeffects on afﬁnity observed previously for nativeBsBL2 and its structural variants [2] are valid, at leastqualitatively. ... His-tagged PyrR and a partial speciﬁc volumeof 0.7450 cm3Æg)1was calculated from the sequence ofthe native protein; an approximate value for RNA(0.51 cm3Æg)1) was obtained from Table ... velocity analysis of native and His-tagged PyrR.Table S4. Sedimentation velocity constants from thetitration of BcBL2 with PyrR.This material is available as part of the online article from http://www.blackwell-synergy.comPlease...

Báo cáo khoa học: Mycobacterium tuberculosis H37Rv ESAT-6–CFP-10 complex formation confers thermodynamic and biochemical stability docx

... hairpin conformation and areorientated antiparallel to each other. The contact sur-face between ESAT-6 and CFP-10 is primarily hydro-phobic, and van der Waals interactions betweenESAT-6 and ... endonucleases, T4 DNAligase and DNA size markers were from New England Bio-labs (Beverly, MA, USA). Taq polymerase and other rea-gents for PCR, and the Plasmid Miniprep kit, theMaxiprep kit and ... Bal1, Kandala V. R. Chary2 and Ashish Arora11 Molecular and Structural Biology, Central Drug Research Institute, Lucknow, India2 Department of Chemical Science, Tata Institute of Fundamental...

Tài liệu Báo cáo khoa học: TMPRSS13, a type II transmembrane serine protease, is inhibited by hepatocyte growth factor activator inhibitor type 1 and activates pro-hepatocyte growth factor pdf

... Tsubouchi H, Naka D, Takahashi K,Okigaki M, Arakaki N, Nakayama H, Hirono S, Sakiy-ama O, Takahashi K et al. (1989) Molecular cloning and sequence analysis of cDNA for human hepatocytegrowth factor. ... Yokohama, Japan2 Advanced Medical Research Laboratory, Mitsubishi Tanabe Pharma Corporation, Kamoshida-cho, Aoba-ku, Yokohama, JapanIntroductionType II transmembrane serine proteases (TTSPs) arestructurally ... sets: 5¢-TCCCATCTGTAGCAGCAACT-3¢ and 5 ¢-GGATTTTCTGAATCGCACCT-3¢ forTMPRSS13 (34 cycles), and 5¢-ATGGAGGCTGCTTGGGCAACA-3¢ and 5¢-ACAGGCAGCCTCGTCGGAGG-3¢for HAI-1 (26 cycles). The GAPDH-speciﬁc...

Báo cáo khoa học: Macrocypins, a family of cysteine protease inhibitors from the basidiomycete Macrolepiota procera pot

... cysteine proteasespapain, cathepsin L and cathepsin V using benzyloxycar-bonyl (Z)-Phe-Arg-7-amido-4-methylcoumarin (AMC) assubstrate, and for legumain with Z-Ala-Ala-Asn-AMC asthe substrate, ... Supplementary Data in Doc. S1 and Doc. S2 and Fig. S1 and S2).Cloning and analysis of macrocypin cDNA and gene sequencesThe N-terminal sequence (H2N-GLEDGLYTIRHLVEGQPPNIPGGMYASSKDGKDXPVTAEPPLP) and the ... for analysing proteolyticmechanisms and protein protein interactions, and asbiocidal agents against various organisms. There areseveral groups of inhibitors, mainly from animal and plant origins,...

Xem thêm