Báo cáo khoa học: The HS:19 serostrain of Campylobacter jejuni has a hyaluronic acid-type capsular polysaccharide with a nonstoichiometric sorbose branch and O-methyl phosphoramidate group docx
Báo cáo khoa học: The HS:19 serostrain of Campylobacter jejuni has a hyaluronic acid-type capsular polysaccharide with a nonstoichiometric sorbose branch and O-methyl phosphoramidate group docx
... Journal compilation ª 2006 FEBS 3989 The HS:19 serostrain of Campylobacter jejuni has a hyaluronic acid-type capsular polysaccharide with a nonstoichiometric sorbose branch and O-methyl phosphoramidate ... Sciences, National Research Council of Canada, Ottawa Ontario, Canada Campylobacter jejuni is one of the leading causes of human gastroenteritis and surpasses Salmonella, Shig-ella and Escherichia in ... (2005) The HS: 1 sero-strain of Campylobacter jejuni has a complex teichoicacid-like capsular polysaccharide with nonstoichiometric fructofuranose branches and O-methyl phosphoramidate groups....
- 15
- 430
- 0
Tài liệu Báo cáo khoa học: The tandemly repeated domains of a b-propeller phytase act synergistically to increase catalytic efficiency doc
... domain and the functionalrelationship of tandemly repeated domains in BPPs. We conjecture thatdual-domain BPPs have succeeded evolutionarily because they can increase the amount of available ... wasdetermined using the Bradford assay with BSA as the standard [28].Phytase activity assayPhytase activity was determined by measuring the amount of phosphate released from InsP6using a modified ferroussulfate ... 1. The higherspecific activity kcat and Vmaxvalues and lower Kmvalue of PhyH suggests that PhyH is more catalytically efficient and has a greater affinity for InsP6than PhyH-DII.Substrate...
- 9
- 801
- 0
Tài liệu Báo cáo khoa học: The thioredoxin-independent isoform of chloroplastic glyceraldehyde-3-phosphate dehydrogenase is selectively regulated by glutathionylation docx
... damage of chloroplastic A 4-GAPDH.ResultsInactivation of A 4-GAPDH by GSSG and otheroxidants, and protection by substrate and cofactorsIncubation of recombinant Arabidopsis A 4-GAPDH with ... Arabidopsis A 4-GAPDH The sequence encoding the putative mature form of the A. thaliana plastidial A 4-GAPDH isoform (GapA-1 cDNAAt3g26650 provided by TAIR, Stanford, CA, USA) wasamplified by PCR using the following ... JP & Branlant G(1998) Comparative study of the catalytic domain of phosphorylating glyceraldehyde-3-phosphate dehydro-genases from bacteria and archaea via essential cysteineprobes and...
- 15
- 515
- 0
Tài liệu Báo cáo khóa học: The C-terminal domain of Escherichia coli Hfq increases the stability of the hexamer ppt
... hexameric state (U6) and monomeric state (6 U). Figure 4A shows that the native form of Hfq has an apparent molecular mass of 50 ± 10 kDa, while the unfolded state of Hfq has anaverage apparent ... betweenProteobacteria, Firmicutes, Thermotogales and Aquificales. On the contrary, the C-terminal fragments are variable in length and amino acidcomposition. The position of Helix H1 and of the five b-strands ... suggests a conformational change at the interface between the subunits (Fig. 2C, bottom-right), thathave been described as the strand b4ofchainBandthestrand b5 of chain A in the crystal structure...
- 8
- 427
- 0
Tài liệu Báo cáo khoa học: "The grapho-phonological system of written French: Statistical analysis and empirical validation" pdf
... grapheme-phoneme mappings and hence, that they are more consistent with a parallel distributed approach than with the abstract rules hypothesis. . Statistical analysis of grapho- phonological correspondences ... impose a substantial restatement of the theory, because it violates the core assumption of the approach, namely, that language users induce all- or-none rules from the language to which they are ... models in the dual route framework can always be adapted to fit the empirical data. Although specific proposals might be refuted on the basis of empirical data, the general approach cannot."...
- 7
- 502
- 0
Tài liệu Báo cáo khoa học: The isolation and characterization of cytochrome c nitrite reductase subunits (NrfA and NrfH) from Desulfovibrio desulfuricans ATCC 27774 Re-evaluation of the spectroscopic data and redox properties ppt
... compriseCytc_DdesCytc_DgigNrfH_WsucNrfH_SdelNrfH_DdesCymA_SputNapC_RsphNapC_PpanNapC_AbraNapC_Paer VDAPADMV.IKAPAGAKVTKAPV AFSHKGHASM VDVPADGAKIDFIAGGE.KNLTV VFNHSTHKDV MNKSKFLVYSSLVVFAI ALGLFVYLVNASKALSYLSSDPKACI NCHVM. NPQYAT MKNSNFLKYAALGAFIVAIGFFVYMLNASKALSYLSSDPKACI ... nature(Fig. 1, lane 1).However, in the absence of boiling (Fig. 1A, lanes 2 and 4) high molecular mass bands of approximately 110 kDa and > 200 kDa were visible, as well as a faint band at37 ... hemes are allin a low-spin state (S ¼ 1/2). One of them has a gmaxat 3.55,characteristic of bis-histidinyl iron ligands in a noncoplanararrangement, and has a positive reduction potential.Keywords:...
- 12
- 593
- 0
Tài liệu Báo cáo khoa học: "The Structure and Process of Talking About Doing" pdf
... a oct+sAn aununS, with a oor~aAn smotmt oF nalIAenoln, and ~he more oaIAent a preoeaa As, 5he lar|er %5e %npae5 on oSher presences (and therefore on the overall prooeaoLng). There ere ... name tank. Than %e the evaluatAon 5eat oemmon%y used today For strafe.sial AntelIA|enee models. A more r~l;orous 5eat %e 5n Cry to F~.5 a mode/. 50 • emma OF data. ?hAs ~e the evaluate.on ... numerical value ,e. '([: One numerical value.) There are ten different letters and each of them has one numerloal value. Therefore, Z san, iooklng at the Wo D's each D is 5; therefore,...
- 4
- 584
- 0
Báo cáo khoa học: The N-terminal region of the bacterial DNA polymerase PolC features a pair of domains, both distantly related to domain V of the DNA polymerase III s subunit ppt
... The actual DNA synthesis is performed by the catalytic a- subunit (PolIIIa), which belongs to the C-family of DNA polymerases [2]. Polymerases of the C-family fall into two major groups, DnaE and ... DNA replication at the elongation step, including the different interactionsthat coordinate leading and lagging strand synthesis.Although bacterial DNA replication has been stud-ied for decades, ... PolC and DnaE. The ability to bind sin-gle-stranded DNA has indeed been demonstrated for the E. coli DnaE OB domain [12,16]. The very N-ter-minal region of PolC and the C-terminal domain of DnaE...
- 10
- 419
- 0
Báo cáo khoa học: The oleic acid complexes of proteolytic fragments of a-lactalbumin display apoptotic activity pdf
... Fluka (Buchs, Switzerland). All otherchemicals were of analytical reagent grade and were Sigmaor Fluka products.Preparation of the OA complexes of a- LAfragments The a- LA fragments investigated, ... wasshown that the fragments acquire an enhanced content of a- helical secondary structure upon binding OA. The physical and aggregation state of OA at physiologicalpH was analyzed by fluorescence and ... binding of the protein.Abbreviations a- LA, a- lactalbumin; BAMLET, bovine a- lactalbumin made lethal to tumor cells; CAC, critical aggregate concentration; HAMLET, human a- lactalbumin made lethal to...
- 11
- 399
- 0
Báo cáo khoa học: The Saccharomyces cerevisiae orthologue of the human protein phosphatase 4 core regulatory subunit R2 confers resistance to the anticancer drug cisplatin pot
... pF 6a- HIS3MX6GGCAATTGGAGTGACATAGCAGCTACTACAACTACAAAAGCAAAATCTCCACAAAGTAATCGGATCCCCGGGTTAATTAAR13 TUB2 deletion pF 6a- HIS3MX6CCAAGTGCTTCAATCCTAGAGAAGAAGAAAGGTAAGAAAAAGAAAGGAAAGCAACTTAATGAATTCGAGCTCGTTTAAACResistance ... tag pFA 6a- 13Myc-HIS3MX6CAAATGGGAAGTTGTTGGTAGAGAAGTCATCTCTCGATCAGAATTCGAGCTCGTTTAAACF3 PPH21 N-terminal 3HA tag pMPY-3xHACATAGTGGAAAGAGGGATATAAATTATCGCATAAAACAATAAACAAAAAGAAAAATGAGGGAACAAAAGCTGGAGR3 ... 3HA tag pMPY-3xHAGAAATACTATTGAAGCTCAAAAACATCCATAATAAAAGGAACAATAACAATGGTAAGGGAACAAAAGCTGGAGR6 SIT4 N-terminal 3HA tag pMPY-3xHAGCGCCTGGCATTTCTTTATTGTTTCAAGCCATTCGTCGGGGCCTCTAGACTGTAGGGCGAATTGGGF13...
- 13
- 389
- 0
Từ khóa: tài liệu báo cáo khoa học bản chất của khủng hoảng kinh tế thế giới pdflam the nao de tom tat bao cáo khoa hocbáo cáo khoa họcbáo cáo khoa học mẫubáo cáo khoa học y họcbáo cáo khoa học sinh họcBáo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018Nghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoạiGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitGiáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôitĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWANQuản lý hoạt động học tập của học sinh theo hướng phát triển kỹ năng học tập hợp tác tại các trường phổ thông dân tộc bán trú huyện ba chẽ, tỉnh quảng ninhPhát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninhTrả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)Nghiên cứu, xây dựng phần mềm smartscan và ứng dụng trong bảo vệ mạng máy tính chuyên dùngNghiên cứu về mô hình thống kê học sâu và ứng dụng trong nhận dạng chữ viết tay hạn chếNghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúngThơ nôm tứ tuyệt trào phúng hồ xuân hươngKiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)Quản lý nợ xấu tại Agribank chi nhánh huyện Phù Yên, tỉnh Sơn La (Luận văn thạc sĩ)BT Tieng anh 6 UNIT 2Tăng trưởng tín dụng hộ sản xuất nông nghiệp tại Ngân hàng Nông nghiệp và Phát triển nông thôn Việt Nam chi nhánh tỉnh Bắc Giang (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vậtchuong 1 tong quan quan tri rui roHIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀM