Báo cáo khoa học: Characterization of the bioactive conformation of the C-terminal tripeptide Gly-Leu-Met-NH2 of substance P using [3-prolinoleucine10]SP analogues pdf

... Ó FEBS 2003 Characterization of the bioactive conformation of the C-terminal tripeptide Gly-Leu-Met-NH2 of substance P using [3-prolinoleucine10]SP analogues Jean Quancard, Philippe Karoyan, ... the NK-1 receptor. The structural implications of these results on the bioactive conformation of Leu10 and the C-terminal tripeptide of SPare analyzed by NMR spectroscopy on SP analogues andmolecular ... on the tachykinin NK-1 receptor of [Pro9]SP,[Pro10]SP, [Pro11]SP and both [P c3Met11]SP and [P t3Met11]SP have been previously reported [20,24]. In the case of prolinomethionine incorporation,...

Tài liệu Báo cáo khoa học: Characterization of chitinase-like proteins (Cg-Clp1 and Cg-Clp2) involved in immune defence of the mollusc Crassostrea gigas docx

... Cg-Clp2 appears to beexpressed in both epithelial and conjunctive cell types of the mantle edge, this protein could orchestrate the synthesis of extracellular components and ⁄ or the pro-liferation ... pro-liferation of mantle cells, as was proposed for Cg-Clp1[5]. The postspawning gonad is characterized by the resorption of gonadic tubules and the rebuilding of storage tissues [22]. The expression of ... tran-scripts was carried out to normalize the expression data of Cg-Clp1 and Cg-Clp2 transcripts. The relative level of expression of each target gene was calculated for 100 copies of GAPDH transcript...

Tài liệu Báo cáo khoa học: Characterization of human deoxyribonuclease I gene (DNASE1) promoters reveals the utilization of two transcription-starting exons and the involvement of Sp1 in its transcriptional regulation ppt

... The 5¢-UTRs of the DNASE1messages were separately ampliﬁed by RT-PCR of totalQGP-1 RNA with a primer set of the common reverse primerDN+89 and either of the starting exon-speciﬁc forwardprimers ... 476-bp 5¢-RACEDNA product, of which the 3¢ 380 bp were identical toexons 1–3 from the 5¢-end of the reverse primerDN+231 to the 5¢-end of the region where the sequence of exon 1 reported previously ... over the diagrams indicate the position of the corresponding nucleotides relative to the translation start site, and the numbersin parentheses below the diagram show the position of the corresponding...

Tài liệu Báo cáo khoa học: Characterization of the interaction between the plasma membrane H+-ATPase of Arabidopsis thaliana and a novel interactor (PPI1) doc

... of the ﬁrst 88amino acids of PPI1 may participate in the interactionwith the H+-ATPase and makes PPI1588His6a suitabletool to study the mechanism of action of PPI1. The analysis of the ... func-tion of the concentration of His6PPI188and PPI1588His6. PM treat-ment with the speciﬁed concentrations of His6PPI188(closedtriangles) or PPI1588His6(open triangles) and H+-ATPase ... H+-ATPase was localized in the N-terminus of PPI1. To further characterize the biological activityFig. 4. pH dependence of the activation of A. thaliana PM H+-ATP-ase by PPI1588His6. PM...

Tài liệu Báo cáo khóa học: Characterization of the products of the genes SNO1 and SNZ1 involved in pyridoxine synthesis in Saccharomyces cerevisiae pptx

... stand for Sno 1p, Snz 1p and His-tag,respectively.Name of plasmidPrimerVectorForward BackwardpSNO1 P1 O P2 O pET21dpSNO1H P1 OH P2 OH pET24apSNZ1 P1 Z P2 Z pET21dpSNZ1H P1 ZH P2 ZH pET24a746 Y ... over the entire surface of syntheticmedium plates supplemented with pyridoxine and the growth requirements, and the plates were incubated at30 °C. The colonies that appeared on the supplementedplates ... puriﬁcation of Sno 1p and Snz 1p In light of the similarity in the amino acid sequence of Sno 1p to that of the glutaminase subunit of imidazoleglycerol phosphate synthase [22], Sno 1p may possess the ability...

Tài liệu Báo cáo khoa học: Characterization of promoter 3 of the human thromboxane A2 receptor gene A functional AP-1 and octamer motif are required for basal promoter activity docx

... sense primer)vs. its complement generating pGL3b:Prm3AP)1*, pGL3e:Prm3AP)1*, pGL3b: Prm3aAP)1*, pGL3e:Prm3aAP)1*,pGL3b:Prm3abAP)1*, pGL3e: Prm3abAP)1*, pGL3b:Prm3aaAP)1*, pGL3e:Prm3aaAP)1*, ... protein coupled receptor(GPCR) superfamily, the TXA2receptor or TP is pri-marily coupled to Gq-dependent activation of phos-pholipase (PLC) Cb isoforms [1,3]. In humans, but notin nonprimates, ... but may also play a critical role in the assembly of the preinitiation complex withinTATA-less promoters [47]. The AP-1 complex is com-prised of a group of proteins encoded by the jun(c-Jun,...

Tài liệu Báo cáo khoa học: Characterization and mode of action of an exopolygalacturonase from the hyperthermophilic bacterium Thermotoga maritima doc

... (GalpA)2(Table 1).Subsite mappingOn the basis of the assumptions of Hiromi [30] that the intrinsic rate of hydrolysis (kint) in the productivecomplex is independent of the length of the substrate,Kmand ... QAVIVTLSYADNNGTIDYTPAKVPARFYDFTVKNVTVQDSTGSNPAIEITGDSS : 482RsolPehC : RGGYVRDFHVDNV TLPNG VSLTGAGYGSGLLAGSPINSSVPLGVGARTSANPSASQGGLITFDCDYQP-AK : 513Thther : NGGGARNITFRDSALAYITDNDGSPFLLTDGYSSALPTDTSNWAPDEPTFHDITVENCTVNGSK ... subunit present in the modi-ﬁed hairy regions of apple pectin. Carbohydr Res 279,265–279.39 Ramakrishnan V & Adams MWW (1995) Preparation of genomic DNA from sulfur-dependent hyperthermo-philic...

Tài liệu Báo cáo khoa học: Characterization of ICAM-4 binding to the I domains of the CD11a/CD18 and CD11b/CD18 leukocyte integrins pptx

... (CD11b). The purities of ICAM-1Fc, ICAM-2Fc and ICAM-4Fc fusion proteinswere checked by SDS/PAGE. The preparations contained the expected recombinant proteins and the purity of the proteins ... beenmapped in detail but the epitope for activation dependentmAb 7E3 has been localized to the amino-terminal region of the CD11b I domain [42] overlapping partially with the metal ion-dependent ... Further proof for the interaction of ICAM-4 with these I domains was obtained by compar-ing the ability of recombinant I domain fusion proteins tosupport the adherence of L cell transfectants expressingICAM-1,...

Tài liệu Báo cáo khoa học: Characterization of the promoter for the mouse a3 integrin gene Involvement of the Ets-family of transcription factors in the promoter activity doc

... locatedwithin the 0.5 kb stretch of the sequence between the SalIand SacI sites upstream of exon 1, and that putativesuppressor elements are present between the PstI(approxi-mately 2.5 kb upstream of the ... transcription start sites[33]. The cap site-labeled cDNA library derived frommurine kidney was supplied by Nippon Gene Co., Ltd.(Toyama, Japan). The library was prepared by the cleavage of the cap ... reversetranscriptase. By using the cap site-labeled cDNA library asa template, PCR was performed with a set of two primers;5¢-CAAGGTACGCCACAGCGTATG-3¢ (1RC primer,corresponding to a part of the sequence...

Báo cáo khoa học: Characterization of the rice carotenoid cleavage dioxygenase 1 reveals a novel route for geranial biosynthesis ppt

... max. plot of 350–550 nm. The valuesrepresent the proportion of each dialdehyde in the sum of the threepeak areas. (B) Incubations with apo-10¢-lycopenal (C27), 3-OH-c-car-otene and lycopene. ... of the products formed. In a ﬁrst approach, wechecked the site speciﬁcities using synthetic apocarote-nals packed in octyl-b-glucoside micelles. This enabledus to observe the cleavage of the ... some nonphotosyntheticbacteria and fungi. In plants, carotenoids are essentialin protecting the photosynthetic apparatus fromphoto-oxidation, and represent essential constituents of the light-harvesting...

Xem thêm