Báo cáo khoa học: A DmpA-homologous protein from Pseudomonas

Báo cáo khoa học: A DmpA-homologous protein from Pseudomonas sp. is a dipeptidase speciﬁc for b-alanyl dipeptides Hidenobu Komeda and Yasuhisa Asano docx

... 2005 FEBS A DmpA-homologous protein from Pseudomonas sp. is a dipeptidase speciﬁc for b -alanyl dipeptides Hidenobu Komeda and Yasuhisa Asano Biotechnology Research Center, Toyama Prefectural University, ... L-Ala-(Gly) 2 (L-Ala) 2 , L-Ala-D-Ala, L-Ala-D-Ala-L-Ala, DL-Ala-DL-Asn, DL-Ala-DL-Ile, DL-Ala-DL-Leu, DL-Ala-DL-Met, DL-Ala- DL-Phe, DL-Ala-DL-Ser, DL-Al...

Ngày tải lên : 07/03/2014, 21:20

10
406
0

Tài liệu Báo cáo khoa học: Cell surface nucleolin on developing muscle is a potential ligand for the axonal receptor protein tyrosine phosphatase-r ppt

... extracellular ligands of the RPTPs in the neuromuscular system. For example, it is known that PTPd and an isoform of LAR can interact homophilically [39] and that LAR can also bind heterophilically ... black dots, protease cleavage sites. (B) SDS ⁄ PAGE separation of FN3d–AP puriﬁed from conditioned media using anti-placental alkaline phosphatase (PLAP) agarose. (C) SDS ⁄ PAGE and...

Ngày tải lên : 19/02/2014, 05:20

14
669
0

Báo cáo khoa học: Purine nucleoside phosphorylases from hyperthermophilic Archaea require a CXC motif for stability and folding pot

... phosphorylases from hyperthermophilic Archaea require a CXC motif for stability and folding Giovanna Cacciapuoti, Iolanda Peluso, Francesca Fuccio and Marina Porcelli Department of Biochemistry ... was analyzed by catalytic activity measurements performed under standard condi- tions. Reactivation assay of SsMTAPII, PfPNP and their CXC-lacking mutants The activity of SsCSC and Pf...

Ngày tải lên : 07/03/2014, 00:20

7
496
0

Báo cáo khoa học: The Rieske protein from Paracoccus denitriﬁcans is inserted into the cytoplasmic membrane by the twin-arginine translocase doc

... sequences, the ISP of P. denitriﬁcans was listed as a potential substrate for what was later named the Tat pathway [10]. To substantiate this assignment, the P. denitriﬁcans ISP was initially analysed ... permits substantial ISP transport. Comparative sequence analysis reveals characteristics com- mon to Tat signal peptides in several bacterial ISPs; however, there are distinctive featu...

Ngày tải lên : 07/03/2014, 11:20

14
535
0

Báo cáo khoa học: Antioxidant Dps protein from the thermophilic cyanobacterium Thermosynechococcus elongatus An intrinsically stable cage-like structure endowed with enhanced stability potx

... Kazusa DNA Research Institute), using primers Dps-Te1 (5¢-CA AAGGAGACT CATATGAGTGCAACAACTAC-3¢) and Dps-Te2 (5¢-CTACAA AAGCTTAATCCGCAACTAACT GAC-3¢). The NdeI and Hin dIII restriction sites are ... 10761 E-mail: andrea.ilari@uniroma1.it Database The atomic coordinates and structure fac- tors have been deposited in the Protein Data Bank, Research Laboratory for Struc- tural Bioinform...

Ngày tải lên : 16/03/2014, 12:20

16
309
0

Báo cáo khoa học: Putative prion protein from Fugu (Takifugu rubripes) ppt

... Japanese medaka (Oryz- ias latipes; GenBank: CAL64054), Japanese seabass (Lateolabrax japonicus) and Japanese ﬂounder (Para- lichthys olivaceus) [18] have been described and com- pared (for a ... Boukouvala E, Panagi- otidis CH, Papadopoulos AI, Sklaviadis T & Krey G (2007) Molecular characterization of a cDNA from the gilthead sea bream (Sparus aurata) encoding a ﬁsh prion...

Ngày tải lên : 30/03/2014, 04:20

8
241
0

Báo cáo khoa học: "Extracting Noun Phrases from Large-Scale Texts: A Hybrid Approach and Its Automatic Evaluation" pot

... text and calculate recall and precision for a comparison. 7. Applications Identification of noun phrases in texts is useful for many applications. Anaphora resolution (Hirst, 1981) is to ... Extracting Noun Phrases from Large-Scale Texts: A Hybrid Approach and Its Automatic Evaluation Kuang-hua Chen and Hsin-Hsi Chen Department of Computer Science and Information...

Ngày tải lên : 31/03/2014, 06:20

8
359
0

Báo cáo khoa học: The signature amidase from Sulfolobus solfataricus belongs to the CX3C subgroup of enzymes cleaving both amides and nitriles Ser195 and Cys145 are predicted to be the active site nucleophiles pot

... 177 A AO55930 PSEDATVVKRLLAAGATVVGKSVCEDLCFSGASFTSASGAVKNPWDLARNAGGSSSGSAV 177 ZP_00124054 PSEDATVVKRLLAAGATVIGKSVCEDLCFSGASFTSATGAVKNPWDLTRNAGGSSSGSAV 177 BAC99079 PSRDATVVTRLLAAGATVAGKAVCEDLCFSGSSFTPASGPVRNPWDPQREAGGSSGGSAA ... ammonia and transformation of the planar thioimidate to a planar thiol acyl-enzyme through a tetrahedral intermediate. Addition of a sec- ond water molec...

Ngày tải lên : 07/03/2014, 21:20

9
478
0

Báo cáo khoa học: The predominant protein arginine methyltransferase PRMT1 is critical for zebrafish convergence and extension during gastrulation pdf

... PRMT1-mediated arginine methylation of PIAS1 regulates STAT1 signaling. Genes Dev 23, 118–132. 16 Yamagata K, Daitoku H, Takahashi Y, Namiki K, Hisatake K, Kako K, Mukai H, Kasuya Y & Fukamizu A ... Cheng, Li-Chun Tu and Han-Ni Chuang for ﬁsh rearing, cDNA preparation and WISH probe preparation. References 1 Bedford MT & Clarke SG (2009) Protein arginine methylation in mam...

Ngày tải lên : 28/03/2014, 23:20

13
368
0

Báo cáo khoa học: Modeled ligand-protein complexes elucidate the origin of substrate speciﬁcity and provide insight into catalytic mechanisms of phenylalanine hydroxylase and tyrosine hydroxylase pptx

... total electric charge was +6 for 5pah and )16 for 2toh, as 2toh comprises the catalytic core domain and the tetramerization domain. BH 4 is uncharged. The aroma- tic amino acids phenylalanine and ... groups. Two alter- native conformations, rotated 180° around an imaginary iron–catecholamine axis, were found for DA and L -DOPA in PAH and for DA in TH. Electrostatic forces...

Ngày tải lên : 31/03/2014, 07:20

11
335
0

Báo cáo khoa học: A DmpA-homologous protein from Pseudomonas sp is a dipeptidase speciﬁc for b-alanyl dipeptides Hidenobu Komeda and Yasuhisa Asano docx