Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt

... Thomas-Oates, J.E. & Brade, H. (1994) Preparationand structural analysis of oligosaccharide monophosphatesobtained from the lipopolysaccharide of recombinant strains of Salmonella minnesota ... conclusion, the data above allowed the identiﬁcation of the carbohydrate backbone from alkaline degradation of the rough form LPS from P. stutzeri OX1. Isolation, NMR and MS analyses of oligosaccharide ... SancheZ.Carballo, P., Haras, D. & Za¨hringer, U. (2003) Structure of a highly phosphorylated lipopolysaccharide core in the Delta algCmutants derived from Pseudomonas aeruginosa wild -type strainsÓ...

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... the synthesis of thermozeaxanthins andthermobiszeaxanthins, which are the main carotenoids of T. thermophilus [15]. The insertion of thermozeax-anthins and thermobiszeaxanthins into the cell ... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... FNR from Azotobacter vinelandii, ZP_00417949; FNR from Rhodobact-er capsulatus, AAF35905; ADR from Homo sapiens, AAB59498; adrenodoxin reductase from Saccharomyces cerevisiae, AAB64812; FprAfrom...

Tài liệu Báo cáo khoa học: Cosubstrate-induced dynamics of D-3-hydroxybutyrate dehydrogenase from Pseudomonas putida ppt

... distance of about14 A ˚between the C2 of nicotinamide and the C6 of the adenine ring. As indicated in the superpositions of Figs 2 and 3, the main difference is the displacement of Ala88 and ... is a result of cosubstrate binding and that it is not a result of crys-tal packing interactions. The nature of the conforma-tional change could be characterized in detail by a comparison of the ... a mechanical hinge (Fig. 6) [14]. An analysis of the mainchain conformations in the different loop structuresshowed that several small changes of main-chain tor-sion angles of the bending residues...

Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx

... 5¢-AAGTAGGCGGAGTATCGAAC-3¢ (sense) and5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primersfor unmethylated DNA were: 5¢-GAAGTAGGTGGAGTATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCTACTT-3¢ (antisense).Caspase 3 activityCells ... Relativeﬂuorescence intensity was determined using imagemaster2d elite software 4.01 (Amersham Bioscience, Uppsala,Sweden).Statistical analysisData in bar graphs are expressed as the mean and standarddeviation ... additionaloccludin variant deleted in exon 9 (OccDE9). On the basis of a comparative analysis of the involvement of wild -type occludin (OccWT) and variant occludin in apoptosis and invasion, as determined...

Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt

... evolutionary aspects of invertebrate tachykininand tachykinin-related peptideAtsuhiro Kanda, Kyoko Takuwa-Kuroda, Masato Aoyama and Honoo SatakeSuntory Institute for Bioorganic Research, Osaka, JapanTachykinins ... 8,459–467.10 Kanda A, Iwakoshi-Ukena E, Takuwa-Kuroda K &Minakata H (2003) Isolation and characterization of novel tachykinins from the posterior salivary gland of the common octopus Octopus vulgaris. ... into tachykinin-related peptides, their receptors,and invertebrate tachykinins: a review. Zool Sci 5,533–549.7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy-ama M, Minakata H, Chiba T, Metoki...

Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt

... NADPHwere also obtained from Sigma. Sephadex G-25 was pur-chased from Pharmacia (Uppsala, Sweden). All the othermaterials were of analytical grade and obtained from Beijing Chemical Plant (Beijing, ... First, the substrate-binding site should match the size andshape of the substrates, and second, incorporation of an imido-group increases the stability of transitionstate selenolate in the catalytic ... GSH, indicating that incorporation of the imido-group in the proximity of the selenium atom mayincrease the stability of the nucleophilic intermediateselenolate and enhance GPX-like activity in...

Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc

... [6,8,27] or toany other sequences available in FASTA and BLASTdatabase programs at the DNA Data Bank of Jap an.Recently, we reported the cloning and s equencing of the gene encoding 4-amino-3-hydroxybenzoate ... and2-aminomuconic acid in the modiﬁed meta-cleavage path-way (Fig. 1B). The 2-aminomuconate deaminase from s trainAP-3 and that from strain JS45 have been puriﬁed andcharacterized in detail [5,6]. The nucleotide ... restingcells of a mutant, strain Y-2, of the aniline-assimilating Pseudomonas sp. strain AW-2 [20].ResultsSpectral changes during metabolism of 4-amino-3-hydroxybenzoic acid by crude extracts of strain...

Tài liệu Báo cáo khoa học: A novel c-N-methylaminobutyrate demethylating oxidase involved in catabolism of the tobacco alkaloid nicotine by Arthrobacter nicotinovorans pAO1 ppt

... to clone the MABO gene. The DNA fragment carrying the MABOORF was ampliﬁed with the primer pair 5¢-GACCTGAGTAGAAATGGATCCCTGA TGGACAGG-3¢and 5¢-GGAATGGCTCGAGGGATCATCACC-3¢ bear-ing the restriction ... role in the biodegradation of a n a lmost unlimited spectrum of naturaland man-made organic compounds, among them the tobacco alkaloid nicotine. Perhaps analysed in greatestdetail is the pathway ... an indication that binding and positioning of the ﬂavin cofactor a t the active site was not affected. Replace-ment of tryptophan with serine (W66S), also abolishedcovalent binding of FAD a...

Tài liệu Báo cáo khoa học: "A Novel Feature-based Approach to Chinese Entity Relation Extraction" ppt

... both internal and external context. Internal context includes the characters inside two entities and the characters inside the heads of two entities. External context involves the characters around ... and then subtypes under a certain type) . However, these two strategies lack of interaction between the two classification levels. To insure consistency in an interactive manner, we rank the ... least at current stage. In this paper, we study a feature-based approach that basically integrates entity related information with context information. 3.1 Classification Features The classification...

Tài liệu Báo cáo khoa học: A novel nuclear DNA helicase with high speciﬁc activity from Pisum sativum catalytically translocates in the 3¢ﬁ5¢ direction docx

... VI)showed a linear rate up to 30 min (Fig. 4A) . After furtherincubation it deviated from the linearity and becamesaturated at  60 min. Titration of helicase activity withincreasing amounts of the ... kinase and DNA polymerase I were from New England Biolabs; trypsin was from Serva (Heidel-berg, Germany); the DNA-intercalating compounds dau-norubicin, camptothecin, VP-16 and m-AMSA were from Topogene ... cross-react withantibodies against plant helicases including PDH45 andPDH65 and also against human DNA helicases I, II, IIIand IV (data not shown). ssDNA-dependent ATPaseactivity was present at a...

Xem thêm