Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt

Tài liệu Báo cáo khoa học: A novel c-N-methylaminobutyrate demethylating oxidase involved in catabolism of the tobacco alkaloid nicotine by Arthrobacter nicotinovorans pAO1 ppt

... thebiodegradation of a n a lmost unlimited spectrum of natural and man-made organic compounds, among them thetobacco alkaloid nicotine. Perhaps analysed in greatestdetail is the pathway of nicotine ... the MABOORF was ampliﬁed with the primer pair 5¢-GACCTGAGTAGAAATGGATCCCTGA TGGACAGG-3¢ and 5¢-GGAATGGCTCGAGGGATCATCACC-3¢ bear-ing the restriction e nzyme recognition sites Bam HI and XhoI, respectively. ... c-N-methylaminobutyrate oxidase (MABO) and UV-visible spectra of wild-type and mutant MABO proteins. (A) A mino acid alignment. Amino a cids identical among MABO and one of the relatedenzymes are in bold...

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... 277 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... Fujiwara and Susumu ImaokaNanobiotechnology Research Center and Department of Bioscience, School of Science and Technology, Kwansei Gakuin University,Gakuen, Sanda, JapanCytochrome P450s are associated ... purchased from Toyobo (Osaka, Japan). Emul-gen 911 was a gift from Kao Chemical (Tokyo, Japan).NADPH, NADH and NADP+were purchased fromOriental Yeast (Tokyo, Japan). a- Cyano-4-hydroxycinnamicacid...

Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx

... (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primersfor unmethylated DNA were: 5¢-GAAGTAGGTGGAGTATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCTACTT-3¢ (antisense).Caspase 3 activityCells ... intensity was determined using imagemaster2d elite software 4.01 (Amersham Bioscience, Uppsala,Sweden).Statistical analysisData in bar graphs are expressed as the mean and standarddeviation of three ... Scotto-Lavino E, Du G & Frohman MA (2006) 3¢ EndcDNA ampliﬁcation using classic RACE. Nat Protoc 1,274 2–2 745.29 Szpaderska AM & Frankfater A (2001) An intracellularform of cathepsin...

Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt

... tachykinins: a review. Zool Sci 5,53 3–5 49.7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy-ama M, Minakata H, Chiba T, Metoki H, Satou Y &Satoh N (2004) Tachykinin and tachykinin receptor of an ascidian, ... (2007) 222 9–2 239 ª 2007 The Authors Journal compilation ª 2007 FEBS 2239 A novel tachykinin- related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin- related ... (Octopus vulgaris) .Biochem J 387, 8 5–9 1.25 Kanda A, Takahashi T, Satake H & Minakata H (2006)Molecular and functional characterization of a novel gonadotropin-releasing-hormone receptor isolated...

Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt

... glutathione (GSH)(Scheme 1) and protects lipid membranes and othercellular components against oxidative damage [ 1–4 ]. Itis related to many diseases and is regarded as one of the most important ... thiobarbituric acid reactivesubstances (TBARS) as a marker for lipid per-oxidation, and 6-CySeCD, 6-SeCD and Ebselen asantioxidants in ferrous sulfate ⁄ ascorbate-induced mito-chondrial damage ... experi-ment carried out without the mimic, ascorbate, and ferroussulfate was known as the control group.Biological analysis of mimics againstmitochondrial damageMitochondrial swelling was assayed as...

Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt

... 64,362 6–3 632.7. Arenghi, F.L., Berlanda, D., Galli, E., Sello, G. & Barbieri, P.(2001) Organization and regulation of meta cleavage pathwaygenes for toluene and o-xylene derivative degradation ... Gram-negative bacteria, and their adaptability tomany different pollutants [1].Pseudomonas stutzeri OX1 is a Gram-negative bacteriumisolated from the activated sludge of a wastewater treatmentplant, ... glycoform of theLOS has been found, with the typical oligosaccharidestructure of a potential substrate for chain elongation and O-polysaccharide attachment [4 0–4 2]. In this latter chain a rhamnose...

Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc

... NADPH, and glutamate dehydrogenasewere from Wako Pure Chemicals (Osaka, Japan); meatextract (Extract Ehlrich) w as from Kyokuto Seiyaku Kogyo(Osaka, Japan); and pentaﬂuorophenylhydrazine was ... only as a carbon source, but also as a nitrogensource for g rowth of the assimilating bacteria. Deaminases,which catalyze the release of ammonia, are a key enzyme inthe metabolic pathways of ... 2-amino phenol and its deriva-tives. However, little is known about the metabolic stepsthat lead to the release of ammonia and the properties of thedeaminase.Pseudomonas sp. strain A P-3 and...

Tài liệu Báo cáo khoa học: "A Novel Feature-based Approach to Chinese Entity Relation Extraction" ppt

... phrase chunking information and semi-automatically collected country name list and personal relative trigger word list. Jiang and Zhai (2007) then systematically explored a large space of ... reasonable to conclude that kernel-based especially tree-kernel approaches are not suitable for Chinese, at least at current stage. In this paper, we study a feature-based approach that basically ... Relations between ARG-1 and ARG-2 Since our classifiers are trained on relations instead of arguments, we simply select the first (as in adjacent and separate structures) and outer (as in nested...

Tài liệu Báo cáo khoa học: A novel nuclear DNA helicase with high speciﬁc activity from Pisum sativum catalytically translocates in the 3¢ﬁ5¢ direction docx

... 2A, lane 4) and ssDNA-dependentATPase activity (data not shown) sedimented togetherbetween alcohol dehydrogenase and BSA (fraction 11) and gave a molecular mass of 120 kDa with a sedimen-tation ... including PDH45 and PDH65 and also against human DNA helicases I, II, III and IV (data not shown). ssDNA-dependent ATPaseactivity was present at a level of 0.6 · 103pmol ATPhydrolysed at 37 °C in ... substrates (Fig. 5G and H) wereprepared as described previously [11,15].ATP-dependent DNA helicase and DNA-dependentATPase assaysThe standard DNA helicase reaction was performed in a 10-lL reaction...

Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor docx

... 1CGACAGgtgagt)3069 bpÀcaacagGTATATIntron 2 TTTTGTgtaaat)146 bpÀcaacagGTATAAIntron 3 AGACGGgtatga)469 bpÀtttcagGTAGTGIntron 4 TGCCAGgtatgt)119 bpÀttccagATTCCGFig. 5. Schematic representation ... transmembrane domains and intracellular and extracellular regions displayed high identity to those of mammalian tachykinin receptors and insect tachykinin- related peptide receptors (Fig. 2 and ... represents an inosine residue) and 5¢-CA (A/ G)CA (A/ G)TAIATIGG (A/ G)TT (A/ G)TACAT-3¢, corresponding to amino-acid sequencesRMRTVTNYF (at transmembrane domain II of mamma-lian tachykinin receptors) and...

Xem thêm

Từ khóa: tài liệu báo cáo khoa học bản chất của khủng hoảng kinh tế thế giới pdf tài liệu báo cáo nghiên cứu khoa học tài liệu về báo cáo khoa học báo cáo khoa học tài chính công báo cáo khoa học số loài quý hiếm tại vườn quốc gia ba bể tai lieu bao cao thuc tap khoa co khi Nghiên cứu sự biến đổi một số cytokin ở bệnh nhân xơ cứng bì hệ thống chuyên đề điện xoay chiều theo dạng Nghiên cứu sự hình thành lớp bảo vệ và khả năng chống ăn mòn của thép bền thời tiết trong điều kiện khí hậu nhiệt đới việt nam Nghiên cứu tổ chức pha chế, đánh giá chất lượng thuốc tiêm truyền trong điều kiện dã ngoại Nghiên cứu vật liệu biến hóa (metamaterials) hấp thụ sóng điện tử ở vùng tần số THz Biện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọ Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Phối hợp giữa phòng văn hóa và thông tin với phòng giáo dục và đào tạo trong việc tuyên truyền, giáo dục, vận động xây dựng nông thôn mới huyện thanh thủy, tỉnh phú thọ Phát triển mạng lưới kinh doanh nước sạch tại công ty TNHH một thành viên kinh doanh nước sạch quảng ninh Định tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)Thơ nôm tứ tuyệt trào phúng hồ xuân hương Chuong 2 nhận dạng rui ro Kiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)Tranh tụng tại phiên tòa hình sự sơ thẩm theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn xét xử của các Tòa án quân sự Quân khu (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vật Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật Chiến lược marketing tại ngân hàng Agribank chi nhánh Sài Gòn từ 2013-2015 MÔN TRUYỀN THÔNG MARKETING TÍCH HỢP