Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx

... of wild-type occludin (OccWT) and variant occludin in apoptosis and invasion, as determined by assay, werevealed that exon 9 played a major role in the induc-tion of mitochondria-mediated apoptosis and ... (sense) and 5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primersfor unmethylated DNA were: 5¢-GAAGTAGGTGGAGTATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCTACTT-3¢ (antisense).Caspase 3 activityCells subjected ... apopto-sis and invasion [21]. In this article, we provide evidence of an additional occludin variant deleted in exon 9 (OccDE9). On thebasis of a comparative analysis of the involvement of wild-type...

Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... 277 TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... 5A) . TheFdx ⁄ CYP17 5A1 ratio was saturated at 8 : 1, and theturnover rate at an Fdx ⁄ CYP17 5A1 ratio of 8 : 1 was4 .9- fold greater than that at a ratio of 1 : 1 (Fig. 5B).The addition of appropriate ... thermozeaxanthins and thermobiszeaxanthins, which are the main carotenoids of T. thermophilus [15]. The insertion of thermozeax-anthins and thermobiszeaxanthins into the cell mem-brane reduces...

Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt

... evolutionary aspects of invertebrate tachykinin and tachykinin-related peptideAtsuhiro Kanda, Kyoko Takuwa-Kuroda, Masato Aoyama and Honoo SatakeSuntory Institute for Bioorganic Research, Osaka, JapanTachykinins ... tachykinins: a review. Zool Sci 5,533–5 49. 7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy-ama M, Minakata H, Chiba T, Metoki H, Satou Y &Satoh N (2004) Tachykinin and tachykinin receptor of an ... implica-tions. Biochem J 3 39( 1), 55–61.24 Kanda A, Satake H, Kawada T & Minakata H (2005) Novel evolutionary lineages of the invertebrateoxytocin ⁄ vasopressin superfamily peptides and theirreceptors...

Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt

... NADPHwere also obtained from Sigma. Sephadex G-25 was pur-chased from Pharmacia (Uppsala, Sweden). All the othermaterials were of analytical grade and obtained fromBeijing Chemical Plant (Beijing, ... selenium-containing GPX mimics. We also studied the catalyticmechanism using steady-state kinetics of 6-CySeCDcatalysis and investigated the antioxidant ability of 6-CySeCD using a mitochondria injury ... such asinstability, antigenicity and poor availability, muchattention has been paid to its artiﬁcial imitation [9, 10]. In synthetic approaches, an initial attempt is madeto synthesize organoselenium...

Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt

... the basis of methylation analysis. In agreement with this assignment, a Fig. 5. Negative ion MALDI-TOF mass spectra of oligosaccharide 1 obtained in linear mode at normal (A) and higher laser intensity ... main spin systemswere assigned in the NMR spectra, and all chemical datafound a rational explanation.The presence of a minor spin system (10%) belonging torhamnose (anomeric signal at 4. 89 ... 4,6-disubstituted-HexN and, in small amounts, terminal-Rha and 6-substituted-Glc. In addition, the disaccharide 7-O-carbamoyl-Hep-(1ﬁ3)-Hep was found.Fatty acid analysis revealed the presence of typical fattyacids...

Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc

... [6,8,27] or toany other sequences available in FASTA and BLASTdatabase programs at the DNA Data Bank of Jap an.Recently, we reported the cloning and s equencing of thegene encoding 4-amino-3-hydroxybenzoate ... acid in strain 10d arerevealed.Materials and methodsBacterial strain and growth conditionsBordetella sp. strain 10d was isolated previously [10]. Strain10d w as cultured in medium containing ... restingcells of a mutant, strain Y-2, of the aniline-assimilatingPseudomonas sp. strain AW-2 [20].ResultsSpectral changes during metabolism of 4-amino-3-hydroxybenzoic acid by crude extracts of strain...

Tài liệu Báo cáo khoa học: A novel c-N-methylaminobutyrate demethylating oxidase involved in catabolism of the tobacco alkaloid nicotine by Arthrobacter nicotinovorans pAO1 ppt

... to clone theMABO gene. The DNA fragment carrying the MABOORF was ampliﬁed with the primer pair 5¢-GACCTGAGTAGAAATGGATCCCTGA TGGACAGG-3¢ and 5¢-GGAATGGCTCGAGGGATCATCACC-3¢ bear-ing the restriction ... an indication that binding and positioning of theﬂavin cofactor a t the active site was not affected. Replace-ment of tryptophan with serine (W66S), also abolishedcovalent binding of FAD a ... (MABO) and UV-visible spectra of wild-type and mutant MABO proteins. (A) A mino acid alignment. Amino a cids identical among MABO and one of the relatedenzymes are in bold type. T he enzymes are...

Tài liệu Báo cáo khoa học: "A Novel Feature-based Approach to Chinese Entity Relation Extraction" ppt

... ORG_AFF.INVESTOR/SHARE, …Table 1 Possible Relations between ARG-1 and ARG-2 Since our classifiers are trained on relations instead of arguments, we simply select the first (as in adjacent and ... least at current stage. In this paper, we study a feature-based approach that basically integrates entity related information with context information. 3.1 Classification Features The classification ... but all nine structures are concerned; and (3) similar to (2) but the training data is divided into 9 parts according to structure, i.e. type and subtype classifiers are trained on the data...

Tài liệu Báo cáo khoa học: A novel nuclear DNA helicase with high speciﬁc activity from Pisum sativum catalytically translocates in the 3¢ﬁ5¢ direction docx

... cross-react withantibodies against plant helicases including PDH45 and PDH65 and also against human DNA helicases I, II, III and IV (data not shown). ssDNA-dependent ATPaseactivity was present at a ... EMBO J. 13, 499 1–5001.16. Tuteja,N.,Phan,T N.,Tuteja,R.,Ochem. ,A. &Falaschi ,A. ( 199 7) Inhibition of DNA unwinding and ATPase activities of human DNA helicase II by chemotherapeutic agents. Biochem.Biophys. ... requirements and characterization of DNAunwinding activity of PDH120The enzyme is heat labile and loses its activity uponheating at 56 °C for 1 min (data not shown). Signiﬁcantunwinding activity was...

Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor docx

... DDBJ/EMBL/GenBankdatabases under accession number AB081457.Intron 1CGACAGgtgagt)30 69 bpÀcaacagGTATATIntron 2 TTTTGTgtaaat)146 bpÀcaacagGTATAAIntron 3 AGACGGgtatga)4 69 bpÀtttcagGTAGTGIntron 4 TGCCAGgtatgt)1 19 ... represents an inosine residue) and 5¢-CA (A/ G)CA (A/ G)TAIATIGG (A/ G)TT (A/ G)TACAT-3¢, corresponding to amino-acid sequencesRMRTVTNYF (at transmembrane domain II of mamma-lian tachykinin receptors) and ... sequenceincluding the transmembrane domains and intracellular and extracellular regions displayed high identity to those of mammalian tachykinin receptors and insect tachykinin-related peptide...

Xem thêm

Từ khóa: tài liệu báo cáo nghiên cứu khoa học tài liệu về báo cáo khoa học báo cáo khoa học tài chính công báo cáo khoa học số loài quý hiếm tại vườn quốc gia ba bể tai lieu bao cao thuc tap khoa co khi Báo cáo thực tập tại nhà thuốc tại Thành phố Hồ Chí Minh năm 2018 Nghiên cứu tổ hợp chất chỉ điểm sinh học vWF, VCAM 1, MCP 1, d dimer trong chẩn đoán và tiên lượng nhồi máu não cấp Nghiên cứu tổ chức chạy tàu hàng cố định theo thời gian trên đường sắt việt nam Biện pháp quản lý hoạt động dạy hát xoan trong trường trung học cơ sở huyện lâm thao, phú thọ Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN SLIDE Quản lý hoạt động học tập của học sinh theo hướng phát triển kỹ năng học tập hợp tác tại các trường phổ thông dân tộc bán trú huyện ba chẽ, tỉnh quảng ninh Trả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)Nghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúng Định tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)Kiểm sát việc giải quyết tố giác, tin báo về tội phạm và kiến nghị khởi tố theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn tỉnh Bình Định (Luận văn thạc sĩ)BT Tieng anh 6 UNIT 2 Tranh tụng tại phiên tòa hình sự sơ thẩm theo pháp luật tố tụng hình sự Việt Nam từ thực tiễn xét xử của các Tòa án quân sự Quân khu (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vật Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật Chiến lược marketing tại ngân hàng Agribank chi nhánh Sài Gòn từ 2013-2015 HIỆU QUẢ CỦA MÔ HÌNH XỬ LÝ BÙN HOẠT TÍNH BẰNG KIỀM