Tài liệu Báo cáo khoa học: A novel electron transport system for thermostable CYP175A1 from Thermus thermophilus HB27 doc

... TSIPGVYACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYAN-PALKVNPGHSSEKAAPGT 335E. coli 277 TSIPGVFAAGDVMDHI YRQAITSAGTGCMAALDAERYLD GLADAK 321 A. pernix 283 TSIPGIFAAGDCTSMWPGFRQVVTAAAMGAVAAYSAYTYLQEKGLYKPKPLTGLK ... Authors Journal compilation ª 2009 FEBS 2429 A novel electron transport system for thermostable CYP17 5A1 from Thermus thermophilus HB27 Takao Mandai, Shinsuke Fujiwara and Susumu ImaokaNanobiotechnology ... DNA poly-merase was purchased from Toyobo (Osaka, Japan). Emul-gen 911 was a gift from Kao Chemical (Tokyo, Japan).NADPH, NADH and NADP+were purchased from Oriental Yeast (Tokyo, Japan). a- Cyano-4-hydroxycinnamicacid...

Tài liệu Báo cáo khoa học: A novel type of highly negatively charged lipooligosaccharide from Pseudomonas stutzeri OX1 possessing two 4,6-O-(1-carboxy)-ethylidene residues in the outer core region ppt

... Gram-negative bacteria, and their adaptability tomany different pollutants [1].Pseudomonas stutzeri OX1 is a Gram-negative bacteriumisolated from the activated sludge of a wastewater treatmentplant, ... the data above allowed the identiﬁcationof the carbohydrate backbone from alkaline degradation ofthe rough form LPS from P. stutzeri OX1.Isolation, NMR and MS analyses of oligosaccharide 2 from ... Catania, ItalyPseudomonas stutzeri OXI is a Gram-negative microorgan-ism able to grow in media containing aromatic hydrocar-bons. A novel lipo-oligosaccharide from P. stutzeri OX1was isolated...

Tài liệu Báo cáo khoa học: A novel splice variant of occludin deleted in exon 9 and its role in cell apoptosis and invasion docx

... (sense) and5¢-GAAAAAACGCGATCCTACTT-3¢ (antisense). Primers for unmethylated DNA were: 5¢-GAAGTAGGTGGAGTATTGAAT-3¢ (sense) and 5¢-CAAAAAAACACAATCCTACTT-3¢ (antisense).Caspase 3 activityCells ... intensity was determined using imagemaster2d elite software 4.01 (Amersham Bioscience, Uppsala,Sweden).Statistical analysisData in bar graphs are expressed as the mean and standarddeviation of ... caspase assay were seeded on a 24-well plate and transfected with FuGENE 6. The caspaseassay was performed using the CaspACE colorimetric assaykit as described by the manufacturer (Promega)....

Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor of Octopus vulgaris – evolutionary aspects of invertebrate tachykinin and tachykinin-related peptide ppt

... vulgaris).Biochem J 387, 85–91.25 Kanda A, Takahashi T, Satake H & Minakata H (2006)Molecular and functional characterization of a novel gonadotropin-releasing-hormone receptor isolated from the ... 8,459–467.10 Kanda A, Iwakoshi-Ukena E, Takuwa-Kuroda K &Minakata H (2003) Isolation and characterization of novel tachykinins from the posterior salivary gland ofthe common octopus Octopus vulgaris. ... & Minakata H (2003)Insight into tachykinin-related peptides, their receptors,and invertebrate tachykinins: a review. Zool Sci 5,533–549.7 Satake H, Ogasawara M, Kawada T, Masuda K, Aoy-ama...

Tài liệu Báo cáo khoa học: A novel dicyclodextrinyl diselenide compound with glutathione peroxidase activity ppt

... CumOOH, and NADPHwere also obtained from Sigma. Sephadex G-25 was pur-chased from Pharmacia (Uppsala, Sweden). All the othermaterials were of analytical grade and obtained from Beijing Chemical ... thiobarbituric acid reactivesubstances (TBARS) as a marker for lipid per-oxidation, and 6-CySeCD, 6-SeCD and Ebselen asantioxidants in ferrous sulfate ⁄ ascorbate-induced mito-chondrial damage ... swelling and a decrease in mitochondria integrity.TBARS content in ferrous sulfate ⁄ ascorbate-treatedmitochondria was analyzed by thiobarbituric acid assay[34]. In this assay, thiobarbituric acid...

Tài liệu Báo cáo khoa học: A novel coupled enzyme assay reveals an enzyme responsible for the deamination of a chemically unstable intermediate in the metabolic pathway of 4-amino-3-hydroxybenzoic acid inBordetellasp. strain 10d doc

... NADPH, and glutamate dehydrogenasewere from Wako Pure Chemicals (Osaka, Japan); meatextract (Extract Ehlrich) w as from Kyokuto Seiyaku Kogyo(Osaka, Japan); and pentaﬂuorophenylhydrazine was ... only as a carbon source, but also as a nitrogensource for g rowth of the assimilating bacteria. Deaminases,which catalyze the release of ammonia, are a key enzyme inthe metabolic pathways of ... not have anabsorbance peak at 300 nm [5]. A cofactor is not required for t he enzyme activity. In contrast, the deaminase from strain 10d contained an FAD-like cofactor, similar toD-amino acid...

Tài liệu Báo cáo khoa học: A novel c-N-methylaminobutyrate demethylating oxidase involved in catabolism of the tobacco alkaloid nicotine by Arthrobacter nicotinovorans pAO1 ppt

... man-made organic compounds, among them thetobacco alkaloid nicotine. Perhaps analysed in greatestdetail is the pathway of nicotine degradation as it takesplace in Arthrobacter nicotinovorans ... c-N-methylamino-butyrate oxidase; megaplasmid pAO1; nicotine degradation;sarcosine o xidase.The bacterial soil community plays a pivotal role in thebiodegradation of a n a lmost unlimited spectrum of naturaland ... 5¢-GACCTGAGTAGAAATGGATCCCTGA TGGACAGG-3¢and 5¢-GGAATGGCTCGAGGGATCATCACC-3¢ bear-ing the restriction e nzyme recognition sites Bam HI andXhoI, respectively. pAO1 DNA, isolated as describedpreviously...

Tài liệu Báo cáo khoa học: "A Novel Feature-based Approach to Chinese Entity Relation Extraction" ppt

... approaches are not suitable for Chinese, at least at current stage. In this paper, we study a feature-based approach that basically integrates entity related information with context information. ... nested, adjacent and separated, are used as feature, and a classifier is trained for each relation type and subtype; (2) similar to (1) but all nine structures are concerned; and (3) similar to ... syntactic parse tree and dependency parse tree. Their experiments showed that using only the basic unit features within each feature subspace can already achieve state-of-art performance,...

Tài liệu Báo cáo khoa học: A novel nuclear DNA helicase with high speciﬁc activity from Pisum sativum catalytically translocates in the 3¢ﬁ5¢ direction docx

... HDH,human DNA helicase; eIF-4 A, eukaryotic translation initiation factor 4A. Property PDH45 a PDH65bPDH120Molecular mass: SDS/PAGE 45.5 kDa 65 kDa 54 and 66 kDaNative 45.5 kDa 65 kDa 120 kDaOligomeric ... substrates (Fig. 5G and H) wereprepared as described previously [11,15].ATP-dependent DNA helicase and DNA-dependentATPase assaysThe standard DNA helicase reaction was performed in a 10-lL reaction ... 2A, lane 4) and ssDNA-dependentATPase activity (data not shown) sedimented togetherbetween alcohol dehydrogenase and BSA (fraction 11)and gave a molecular mass of 120 kDa with a sedimen-tation...

Tài liệu Báo cáo khoa học: A novel tachykinin-related peptide receptor docx

... 1CGACAGgtgagt)3069 bpÀcaacagGTATATIntron 2 TTTTGTgtaaat)146 bpÀcaacagGTATAAIntron 3 AGACGGgtatga)469 bpÀtttcagGTAGTGIntron 4 TGCCAGgtatgt)119 bpÀttccagATTCCGFig. 5. Schematic representation ... reactions(RT-PCRs) and rapid ampliﬁcations of cDNA ends wereperformed using TaqExpolymerase (Takara, Kyoto, Japan)or rTaq DNA polymerase (Toyobo, Osaka, Japan) and a thermal cycler (model GeneAmp PCR system ... 4239PCR anchor primer and a primer (5¢-CGAACACCCAGTGGTTATTCAAC-3¢, complementary to nucleotides693À672), followed by reampliﬁcation using the anchorprimer and a primer (5¢-GATATCAAAGCGTCAGCAACTGC-3¢,...

Xem thêm

Từ khóa: tài liệu báo cáo khoa học bản chất của khủng hoảng kinh tế thế giới pdf a native electron transport system for cyp175a1 has not been identified here tài liệu báo cáo nghiên cứu khoa học tài liệu về báo cáo khoa học báo cáo khoa học công nghệ phục vụ nông nghiệp và phát triển nông thôn các tỉnh phía bắc 2006 2007 tài liệu phục vụ hội nghị nghiên cứu các tài liệu báo cáo của các nhà nghiên cứu đi trước về các lập luận khoa học về trồng và phòng bệnh dịch cho hoa hồng cách quản lý sử dụng phân bón đúng cách vv báo cáo khoa học tài chính công báo cáo khoa học số loài quý hiếm tại vườn quốc gia ba bể tai lieu bao cao thuc tap khoa co khi tai lieu bao cao thuc tap tai khoa duoc benh vien tai lieu bao cao thuc tap y si da khoa báo cáo khoa học ảnh hưởng của tuổi thu hoạch đến năng suất và chất lượng thức ăn của cỏ voi pennisetum purpureum cỏ ghi nê panicum maximum trồng tại đan phượng hà tây pptx tai lieu bao cao thuc tap tim hieu nhan cach mot hoc sinh báo cáo khoa học về nghệ thuật trong lieu trai chi di tai lieu bao cao thuc tap tai khoa duoc benh vien hop luc Báo cáo quy trình mua hàng CT CP Công Nghệ NPV chuyên đề điện xoay chiều theo dạng Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit Giáo án Sinh học 11 bài 13: Thực hành phát hiện diệp lục và carôtenôit ĐỒ ÁN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN NGHIÊN CỨU CÔNG NGHỆ KẾT NỐI VÔ TUYẾN CỰ LY XA, CÔNG SUẤT THẤP LPWAN SLIDE Trả hồ sơ điều tra bổ sung đối với các tội xâm phạm sở hữu có tính chất chiếm đoạt theo pháp luật Tố tụng hình sự Việt Nam từ thực tiễn thành phố Hồ Chí Minh (Luận văn thạc sĩ)Phát triển du lịch bền vững trên cơ sở bảo vệ môi trường tự nhiên vịnh hạ long Phát hiện xâm nhập dựa trên thuật toán k means Nghiên cứu tổng hợp các oxit hỗn hợp kích thƣớc nanomet ce 0 75 zr0 25o2 , ce 0 5 zr0 5o2 và khảo sát hoạt tính quang xúc tác của chúng Nghiên cứu khả năng đo năng lượng điện bằng hệ thu thập dữ liệu 16 kênh DEWE 5000 Định tội danh từ thực tiễn huyện Cần Giuộc, tỉnh Long An (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vật Giáo án Sinh học 11 bài 15: Tiêu hóa ở động vật Nguyên tắc phân hóa trách nhiệm hình sự đối với người dưới 18 tuổi phạm tội trong pháp luật hình sự Việt Nam (Luận văn thạc sĩ)Giáo án Sinh học 11 bài 14: Thực hành phát hiện hô hấp ở thực vật BÀI HOÀN CHỈNH TỔNG QUAN VỀ MẠNG XÃ HỘI Chiến lược marketing tại ngân hàng Agribank chi nhánh Sài Gòn từ 2013-2015 Đổi mới quản lý tài chính trong hoạt động khoa học xã hội trường hợp viện hàn lâm khoa học xã hội việt nam TÁI CHẾ NHỰA VÀ QUẢN LÝ CHẤT THẢI Ở HOA KỲ